lpc3250/0000700000175100017510000000000012301261113007650 5ustar 10011001lpc3250/devcfg0000777000000000000000000000074413767264033012054 0ustar rootrootBC-01ʵʵ,lpc3250/usr/0000777000175100017510000000000012047125040010504 5ustar 10011001lpc3250/usr/www/0000777000175100017510000000000012116307710011333 5ustar 10011001lpc3250/usr/www/netcfg.html0000777000000000000000000001307513635024723014457 0ustar rootroot iDste WEB 配置
网络参数
启用DHCP:
本机IP地址:
子网掩码:
网关:
服务器IP地址:
  自动查找服务器
lpc3250/usr/www/page_node/0000777000000000000000000000000013635025736014240 5ustar rootrootlpc3250/usr/www/page_node/cgi-bin0000777000000000000000000000000013766274657022342 2/opt/lpc3250/usr/www/cgi-binustar rootrootlpc3250/usr/www/page_node/netcfg.html0000777000000000000000000001307513635024723016400 0ustar rootroot iDste WEB 配置
网络参数
启用DHCP:
本机IP地址:
子网掩码:
网关:
服务器IP地址:
  自动查找服务器
lpc3250/usr/www/page_node/index.html0000777000000000000000000003424413635024723016242 0ustar rootroot iDste WEB 配置
系统参数
名称:
(最多32个字符)
位置:
(最多96个字符)
系统启用:
启用  禁用
模拟广播:
启用  禁用
视频广播输出:
投影  电视
视频广播分辨率:
音频输入关闭延时:
(0~255)
运行参数
默认视频输入
计算机  笔记本  展台  上次设定
投影仪型号:
(最多64个字符)
校验位:
屏幕升降时间:
(0~65535)
数据位:
开关时延:
(0~65535)
停止位:
 
波特率:
开机命令:
(最多63个十六进制数)
关机命令:
(最多63个十六进制数)
视频命令:
(最多63个十六进制数)
计算机命令:
(最多63个十六进制数)
音频参数
音频
增益:
音量:
(0~63)
高音:
(0~15)
低音:
(0~15)
关机后保持音量:
 
麦克风
增益:
音量:
(0~63)
高音:
(0~15)
低音:
(0~15)
关机后保持音量:
 
广播
音量:
(0~63)
lpc3250/usr/www/page_node/logo.jpg0000777000000000000000000002362713635024723015712 0ustar rootrootJFIF,,C     C   \" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?-|\Ο[v3QC:h'p@l\gCψm?Q|eIzhRt-Ez?ԃ/5(uGjB/wO>_5O"]qIROEGqi?R>Ɵ򯸥Z?◌m?c7R/gFs3UɥJjʾOmSuc⇌#f>'׭o*UR%G+TgX?a7RKW(;TS*?T>&x?5k_0ĿqN Zv*ʾZ_^.YUL|Zh>_*US/eOWZSu?8X|Ff?g?>_*ڥ+7J򯸥V?oFmcA\KtUs#J;TPUg2|CIW|BN?dտ:_*ץO򯸵V?1#TV?SX-N]a-W5( ^*UI=RsQ|AcBWƤMS?5*Dcإ)w5FcB_ƥ]wR.f/J:TũK7ԉsk5*Tq]sEuC?s[jd/N2Tr>j_n?HTN6]}U~OԃT} P^(P*}5;jWy)RZ#Dtj7YRBTZvE&˩s?fK-TJ*ZE˂}]Ϗf(SdZl.?R%ZjReq.ֿjULeS/JZ'YoΞ%|}R)GevStK)!'HJ*h}QHgW_,>9z䗭u÷=^C~GdJ;TCJ;VJTPZ&AңAҡWJRWL*S/J͚"TRD*T-%N*ӥK)HTPZ%N*Jj DRZ*TR%^"Tk֤J̲QڦJva֤1֤6Z$^:T ֧J(RR H:ԣD:ԣC-N*ץIh:SJbt L0PL;T2*TңJzT2*tRN*T2SD*TPDR%F"T3BaڦJvJ:ԉ֣jDR%^2WL*h*UQ%JjhujujZ&J*$RGjtjte"URD*T0RJtW&Z%N"TiҤJ̤N*TQ/J:TJ*TeZ*S%AdRZ*TPY"GZzԣC(*UQ%JjM(RR՛)%HTRDõJ:TCJ:TWJReUS/JzҥH:TiҤ*h*dPL*H*TJZERK;{޹%]o_,>9z䗭~CP__(RRգ3DRD*Tj0 ('h'PէZ}i MqnA` g'esH&~ _cM@56;9|9Ri'_{º7>2aVzŐ[@Ǹ4xm޾$;*Nwg S2J.x5K㯈v"P)Zk?2FtEvg>lvϯw,w.c-W`2@,r>|EК}X:Kfsv2lz(>X;XxGʩǫ1^%:8xRv{+ac_Vl֎W>8ǂO^,Լ;B!,e)ʰ꬧ cX_c~_ĿƝ]( ͏O7+d <+h0.fi]A?*(8_S ⒡Jur+OMU׫NJ0{m_ZTҽ[_ k?|OH8ԙ7Z(.G8W~߲~sK~"mkynI+vThSNy=JyuzVgT]?φOxVQFIХE_:-׵$7Bv@݅R x8N>jWvl&lvW|djU^B|kkxPѯѤunGWt9z䗭u÷=^C~GdJ;TCJ;VJTPZ&c¿2?+v_L,#.cff8&a#D=|/7.?8O|keco\hCo I#,UCdp1='eu;=&s./XcZ< @j.R9f&2MyUi32M/?3ࣟ(?b'g.xķvڌZڳ oo.eϪJߎ`Ox6d/uwTb0N o'ÿ~k k1GX鉋Hxp\b*_Jziu(ccVZ+뵏#~'7;x2M4מ;R~_120_~Y.`iA{Q}o;ҵ־%OKg̐|ȝA9–\mBtÏ|k:<_mmLZȡmT !b%Y&ot "(zn(5/|! GǶ:^,sΌ Mr1=z_V?UPRy;]SPg^vRV,W5nj>/Śe<)sm}X,Aۆq?ǥ|V4KFM[AxJݩ +]ǿ>3Uӳo-Bۓ x2%N_gF/)aTETg#y+]"c,;%iev}z׶~w Kb;-o&U8*Lw;y=xMz5B> kM[H*TQ%Jkd֤JzԉYJ;TP2TL:ԃF:ԃfD֧JzRZ%QҢQҡZvZveTץ@:-JxLNҡjZ%JzTiR/JR%N*TIҥJZ&^*tJ*h*DҤJhL;TP2T2GZ:cHjYd֦^ C-Jj$WC-߆%s--sKCa$wI9v0)}~حm.YFpgUwmHn.<,3`Wjneh3i6nky'p~yUyS_W=Z\)xFүI4y˞3YiSwp_LcE$/ ])[ѭo5;Xd. hpXs\v[iZjW:M  8 b6\լ2\\E*ZW`Ԓxth"c"mB08gm #soi:=,1_v[ZRoQe4[{K&SĥeFVkؘtúE^^ XH,;\]M埅oWKIhڎAI'-|iїÚK!I7>_Sfh. F&̘O?Za:n-\\[6@Udw ~5/5{˫y!Q)&:.ztrgUM!үik$н9壄,OӜUW􈧟RKe9v9]fsGsA>!;Lя. hs76 1Ү APNZJsrn{B@83ҙv@R ڂ%A#5+ݝѵxі9X0RY?&ַdJ*C1\V2F`M`pL|EY]+ݘL :ʪ)R:ֹV)4l$ # Ec;hfޞoH8zQS>6nd7 Mf{Vl.7ˌ`+V j;Xc礗Gf\GrrĘjVHJ*Ddaڥ*!ڥ*KDҥJzTY*BjeRDҤ*4R L2tRN J*TIRC-) J%?\/vGrKֿ~(z/~Y̔uGjuGjљTRJ* DõH:TcH:T2*R^*T*BjeYDJ*TJDӥ@:te"TJ* D֥^uWAh*TQ%JjYd֤JzԉYJ;TP2TL:ԃF:ԃfD֧JzRZ%QҢQҡZvZveTץ@:-JxLNҡjZ%JzTiR/JR%N*TIҥJZ&^*tJ*h*DҤJhL;TP2T2GZ:cHjYd֦^ C-Jj$WC-i6մVYՓ.kvXnsH;VRdL'5*TIR hI]J!ܾb\+B)(T!$bǯ,a(YJ1{HKftxSeiRRKpAzV,5+ X>tҥJ0~h)|Lt+^N[nWOҥ^4ԤZWZmRXyoSV/ՅԊwn r*D#}mץOo3vFSP/J:Rl#[.cUn2N-yiu=º$<>*VN1k-YK˙'#nf& utױXmKPcȲ jTֳ4/˨PD2[tɨGZzԣE62+NC*Hm慰W{#?T^6FQ[dHT}}j!ڢjQڢ*dR%F"T0RR%URD*Thzҡ^2eDRtJZ&J:T)S'JR%J*$RE~%|eIzW?b/xZαu]ʑ\@]ܱ $$$`>_שg8ӌ[z%~EII%}OGZv?Ⴜ?/? ҏ7#b"?[p]Jq|&*W#&3O_OCb!?O,oe _r[cb!?9a[?yv_yRׁżAp| ?+Լac;/zҾuԃ"0'wB^"Wk;??j?dk5Sc/v'ĵ#b:Tka{We' _X/_/5OoGuyYN)t_yҾu!1 gEjỿ{/\vGJeO CX25yqK*_yR2υ5o¼/7RL?wץ}6?e _n?f/ տ_nO,}Ҟ:W 2x_o2`cu/3qk,v_yZTõ} ?f ~n?f ~nKb;/*E_F?Tp|4?T5;/:T_Cc_uO/ԼƇw|*T_@Ã_u?NGj?"Bwx T^j_?">xxc*^>_du<>?R{EC/>ჭHkܿD#^E8| AC'KG G/ZzWC'N41/ZO"㨖5Jz׳zE8|_)Lk PRJ!M_&u}Se5CҥJ8kpms}/RXy"uu=iZK>{ RTֻ!-n? pU?g*} 8RYk??}C*}J39TWu ;A-&SDž-SbZ#jQں?EGOc*HHҤJ/?¤/?§DNFRn?O;r~c){Hْ*TA?O8iC)A֦^ti=t.HVSN VŌc~tcAݪ[E$RNA*;I*SBOQRERlpc3250/usr/www/page_node/pass.html0000777000000000000000000000576513635024723016107 0ustar rootroot iDste WEB 配置
修改密码
旧密码:
新密码:
确认新密码:
lpc3250/usr/www/page_node/reboot.html0000777000000000000000000000271513635024723016423 0ustar rootroot iDste WEB 配置
lpc3250/usr/www/page_node/js0000777000000000000000000000000013766274657015357 2../jsustar rootrootlpc3250/usr/www/page_node/idste.css0000777000000000000000000000000013766274657020125 2../idste.cssustar rootrootlpc3250/usr/www/idste.css0000777000000000000000000000521613635024723014143 0ustar rootroot* { margin: 0; padding: 0; } body { font-size: 12; margin: 0; padding: 0; text-align: center; } #wrap { width: 900; text-align: left; margin: 0 auto; clear: both; } #header { width: 900; min-width: 900; height: 92; background-image: url('logo.jpg'); background-repeat: no-repeat; float: left; clear: both; } #main { min-width: 800; height: auto !important; float: left; clear: both; overflow: hidden; margin: 0 0 5 0; } #foot { width: 800; clear: both; margin: 10 0 0 0; padding: 10 0 10 0; text-align: center; overflow: auto; } #main_menu { width: 150; height: inherit; float: left; background-color: #F1F1F1; overflow: auto; } #content { float: left; min-width: 750 !important; min-width: 750; width: auto; *width: 750; overflow: auto; background-color: #FFFFFF; } .min_content { min-width: 900; *width: 900; margin: 10 0; height: auto !important; background-color: #F1F1F1; overflow: auto; height: 100%; } .menu { background-color: #F1F1F1; min-width: 400; height: 30; } .menu_item { margin: 5 0 5 0; padding: 0 0 0 15; } .menu_item_selected { background-color: #6699CC; margin: 5 0 5 0; padding: 0 0 0 15; } .menu_item_selected a { color: #FFFFFF; text-decoration: none; font-size: 11px; display: block; padding: 5px; } .menu_item a:hover { background-color: #F1F1F1; color: #404343; display: block; font-size: 11px; font-weight: normal; padding: 5px; text-decoration: underline; } a:link { color: #404343; display: block; font-size: 11px; font-weight: normal; padding: 5px; text-decoration: none; } .menu_item a:visited, .menu_item a:active { color: #404343; display: block; font-size: 11px; font-weight: normal; padding: 5px; text-decoration: none; } #comp { float: left; clear: both; overflow: auto; width: 650; } .comp_item { margin: 0 0 10 20; padding: 0 0 10 0; border: 1px solid #6699CC; width: 600; min-height: 120; overflow: auto; } .item_left { float: left; width: 290; *width: 280; } #error { color: red; font-size: 11; margin: 0 0 0 15; } .error { color: red; font-size: 11; margin: 0 0 0 15; } .item_title { padding: 5 0 5 10; margin: 0 0 15 0; background-color: #6699CC; font-weight: bold; color: #FFFFFF; width: 590; *width: 598; float: left; clear: both; } .line { padding: 3 0 3 15; width: 585; float: left; clear: both; line-height: 1.5; } .label { width: 120; float: left; } .cfg_item { width: 585; padding: 3 0 3 15; font-weight: bold; float: left; clear: both; } .item_left select { width: 70px; } #proj_types { width: 100; } .video_dev { width: 290; } .proj_devs { float: left; width: 280; } .action { margin: 0 5 0 5; } lpc3250/usr/www/index.html0000777000000000000000000003653513635024723014326 0ustar rootroot iDste WEB 配置
系统参数
名称:
(最多32个字符)
位置:
(最多96个字符)
系统启用:
启用  禁用
模拟广播:
启用  禁用
视频广播输出:
投影  电视
视频广播分辨率:
音频输入关闭延时:
(0~255)
运行参数
默认视频输入
计算机  笔记本  展台  上次设定
预设投影仪型号:
投影仪型号:
(最多64个字符)
校验位:
屏幕升降时间:
(0~65535)
数据位:
开关时延:
(0~65535)
停止位:
 
波特率:
开机命令:
(最多63个十六进制数)
关机命令:
(最多63个十六进制数)
视频命令:
(最多63个十六进制数)
计算机命令:
(最多63个十六进制数)
音频参数
音频
增益:
音量:
(0~63)
高音:
(0~15)
低音:
(0~15)
关机后保持音量:
 
麦克风
增益:
音量:
(0~63)
高音:
(0~15)
低音:
(0~15)
关机后保持音量:
 
广播
音量:
(0~63)
lpc3250/usr/www/cgi-bin/0000777000175100017510000000000013452573611012654 5ustar 10011001lpc3250/usr/www/cgi-bin/cgi-bin0000777000000000000000000000000013766274657021731 2/opt/lpc3250/usr/www/cgi-binustar rootrootlpc3250/usr/www/cgi-bin/getnet.cgi0000777000175100017510000010400413635025736014633 0ustar 10011001ELFa(̍44 (444{{( ((( Qtd/lib/ld-linux.so.2GNU%@#> 78;*)9<?"&45 1:20+ -6 !% ,$(. 3/='  ȋԋY2 #o(4@LvX_d8p(n|`:3ČuЌ   ܌{; n$0(L< H( ,ATS`lx|-u(EX libiconv.so.2__gmon_start___Jv_RegisterClasses_fini__data_start_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonlhtonssprintf_IO_putcfopeninet_ntoastrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0Uii ii ii (1,3     $(,048<@DHLPTX\` d!h"l%p&t'x(|)*+,.0456789:;=>- -puƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌ$  --0-a,80-00 0SbrX0p@-0SpH H0`0bC1@C8P 0S :0 p0 4- -0S0S3/- -LK 0C0C0 >K 0C0C 'W70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX00 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C(0S (0$ KP$0 0 0S  jQ=K 0C000 0 00S 00Q-K B}(0S (0 00(0 0S 0 0 00Sc 0 00R8( 0 000S" 00  00a=K 0CD00d0 0 0 0S= 0 0a-K B:q=K 0C-00M0 0 00S& 00q-K B#A>K 0C 0C0050 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00 00S 00 0 0S 0 0 00S 00 00S 00 (0S (00S A>K 0C 0C0*KP4KP4 K p ,D -LM x 00 0s00 x0S 00 00 0 K0 -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 L00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D_80080 !00S 80 40R000 40040 400000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D"80080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000W000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0dH$00L4S L$0000S 0VH4S H$00,0P4 P4 K @ -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 '0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S 0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S |0 040000:S040=S04004 04004 040S b0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0Sz0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000p -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,00@0 0$0 $0S,0000@0 |, $0 0 $0 $000 $0 0 $0 $0 0S ,000$0@0 Y$0 000 $0 $00S,0p00m$0 0i$g0@0 <$0 000 $0 $00S,0S00P$0 0L$00H$F0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 KD -L,M( , 0 0 0 00 00 00 000E0$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 KH -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 KH -LM200 #000 00F00B0 0>00:000S 00I00-+00 0S\10SK P10D10810,10 1010 100000000000000000000000x00 00 00 KD8Hxd| thlP`L  -LM  9 00 0S< 0$0  020$0 $0 KL -L M $ ( 00  00 0S$ 0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 0f0 (00CR0,0 0,0 ,0 KL -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 000 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "00 0S 000 0 00T 0 00S 0 0  000 0 0 KH -LM  $0 00 0S 0(0  0000 0S 0(0 $ 000(0 (0 K -LM 0S 00 00N@00 0 K -LM  00 0S< 70$0  00$0 $0 KL -L$M, 0 00 ,0 0 0S 000 0 0 0S00120$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00000 0!$0@0000!$000S$0 00040 '0!$00 000!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>Kr 1 0 K -LEM  ! 1 C?K,!C/K00!1 KL -LDM0 4 8 <0 $0KZ$ 800(0 (0Ke0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40(K\ -LM 00  \ -LM  00 0 K\ -LM 00  \ -LAMM  00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C00 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4  0$4 $4 K48Hxd| thlP`L TpD -LM  z00 0 00 0R 0 0 0 0 0 K -L M  0K 0p0S00 00 0 K -LM8 0(0 0 0 8?0,0 ,0S0<8 00K,0Sw 00n0S 000<8 00 ,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 j0(0 (0S,,0<8 ( j(0,!0S (p,zX$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CT?00 0S;0 0 ~00 0 S;0  B>K 0C0C,0d00 0S 0 0 >K 0C0C` B>K 0C0C0)0 0R 0 0 >K 0C0CI0 0b0 0S>K 0C0C000 (0 (00S0 0 >K 0C0C'(0 >K 0C0C 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00}(00S (00u(s 0<8 <8 KH8Hxd| thlP`L Tp8,D -LM  0K00S0 0 &00u0 0 00S0 0 0 0 0}0 0R 0 0 0 0 000 0 0 K -L M   0^0S00 00 0 K -L M  00S 00S00 300 000S00 )0 00000;S 00+@00&0T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )0 00000;S 00@000T 00 0 00R 00 000 000 0K -LM $ 000 0 0<D@ -L Mp000 0 \0 0 P000S00  00S00 0 K@< -L M $x00  000 K@ -L M 00 000 000 000 0S K -L M, 00 200 00=S000 000 00S001*0$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S 0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c000 0!$000S$m, 00000 9 0!$00 00c 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00KT -L M, 00 X20$0 H20 0 $0 000S 00 0 $0R000 $00$0 $0S001]0(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 00R0S2 00 0 $0R$00000 0!(0@0000!(000S(, 00000 0!(00 $00000 $00$0 $0S, (00000 00KD -L M  00<S+20&0s 00 20l0s 00 20t0s 00 T20;0s{ 00 00&S620&0s 00 x10a0s 00 m10m0s 00 b10p0s 00 Wh10;0s@ 00 L00>S+,10&0s 00 =10g}0s 00 200tr0s 00 '00;g0s 00 00 p00Y0s 00 000 0S00 00C0 RI00 0 K\ -LM 000 -L M  K00"S6X10&!0s 00 H,10#0s 00 =103 0s 00 20040s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 R00 0 K\ -LM 00 -LM  0S00 p00l T00T x0S 0000 r00}v KX\dx -LM  tA00 0S0$0   0p0S &0$0 !0$0 $0 K -LM  t00 0S0$0   0$0S 0$0 0$0 $0 K -LM  00 0S0$0  0S0$0  00   0R 0$0 0$0 $0 K -LM  u00 0S0$0  0S0$0  }00   0R 0$0 0$0 $0 K -LM 0S $000 000 0 K -LM04 8" 02K00  b00 0S(02KJ02K40$0 02[(2K82S 42S ?K048"N00 82(0K K0  @0 00 X K! -L,M03K0(0  $00 0S040 /(K00 0J00 0S 1040 $0K?02K3[02KT0 0 $0K 0s040 040 40 K -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,.K 0K0  000 0S >K,0w Kl  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T: @-@3/0@Ds--text/plain{"success":"false"}{"success":"true"0,"ip":"%s","net_mask":"%s","gateway":"%s","server":"%s","user":"%s"SERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1KU X H  ЉoxoolllllllllllllllllllllllllllllllllllllllllllllllllPTX\`dhlptx|HPGCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' /7oDoxx @S  \ Љ  eXX `ll `k̍ jqw ww{h((|(p%lpc3250/usr/www/cgi-bin/getrecord.cgi0000777000175100017510000010406013635025736015325 0ustar 10011001ELFa(p4 4 (444}}4 ((( Qtd/lib/ld-linux.so.2GNU%C%A :;>-,<?B$(78 4=53. 09# !)'"/&+1 62@* f$  <HDT`2 lIx+̌8،A4` N,Y8$DP\h   2t]Wȍԍ4r >4 78gy(S4@L4Xdk؋ libiconv.so.2__gmon_start___Jv_RegisterClasses_finilibiconv__data_startlibiconv_closelibiconv_open_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonlhtonssprintf_IO_putcfopeninet_ntoastrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0{ii ii #ii -4486     $(,048<@DHLPTX\` d!h"l#p$t'x(|)*+,-./13789:;<=>@A-a-tƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌX$  --0-X-00 0SY4rX0p@-0SpH H0`0bC1@C8P 0S :0 p< @- -0S0S3/- -LdM70K0' ]00 l0S 10 w0p0 [|10| n7 [60[4 50[8 40[<0}0<0 ,10l0 7 [60[4 50[8 40[<0S <0h0 0h0 lh I0 30[ B0 20[ ;]0K! 70K0] K  0\00] Kh)D0 0[T "(00}&0p0 p0 Kh, -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(4}00 0S 0 4R4030+n30?0 3 00#3030;L0SH |30;D00 = 00000 000 i0 00000:S0S 0 2 200 000 00S I0 00000:S 0 ;00 0S 0K` 0G L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 000 0 0S \000 `00 U000 00 KT<LXpl| tx\l  $0|X@ L\`lP4d8hDx -LM  N 0 00S 00 K -L M00S00 '0000 0S00 x00 p000 P00R 00 40000 400 0 K|d -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$?00 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 K|d -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C 'a70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX00 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C(0S (0$ KP$0 0 0S  tQ=K 0C000 0 00S 00Q-K B(0S (0 00(0 0S 0 0 00Sc 0 00_8( 0 000S" 00  00a=K 0CT00w0 0 0 0S= 0 0a-K BJq=K 0C=00`0 0 00S& 00q-K B3A>K 0C 0C%00H0 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00 00S 00 0 0S 0 0 00S 00 00S 00 (0S (00S A>K 0C 0C0*KP4KP4 K |P -LM x 00 0s00 0S 00 00 0 K -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 \00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00Dr80080 !00S 80 40R000 40040 400000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D580080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000a000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0qH$00L4S L$0000S 0cH4S H$00,0P4 P4 K  -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 40 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S 0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S o0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000| -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,00@0 0$0 $0S,0000@0 |, $0 0 $0 $000 $0 0 $0 $0 0S ,000$0@0 Y$0 000 $0 $00S,0}00z$0 0v$t0@0 <$0 000 $0 $00S,0`00]$0 0Y$00U$S0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 KP -L,M( , 0 0 0 00 00 00 000X0$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 KT -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 KT -LM200 #000 00S00O0 0K00G000S 00Y00:800 0S\10SK P10+D10'810#,10 1010100000 000000000000000000x00 00 00 KPDTp tx\lX  -LM  9 00 0S< 0$0  020$0 $0 K -L M $ ( 00  00 0S$ 0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 0v0 (00CR0,0 0,0 ,0 K -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 00 0 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "00 0S 000 0 00T 0 00S 0 0  000 0 0 K -LM  $0 00 0S 0(0  0000 0S 0(0 $ 000(0 (0 K -LM 0S 00 00[M00 0 K -LM  00 0S< G0$0  00$0 $0 K -L$M, 0 00 ,0 0 0S 000 0 0 0S001E0$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00000 0!$0@0000!$000S$0 00040 '0!$00 000!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!C/K00!1 K -LDM0 4 8 <0 $0Km$ 800(0 (0Kx0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40;Khp -LM 00  *h -LM  00 0 Kh -LM 00   h -LAMM  00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C00 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4  0$4 $4 K Tp tx\lX `|P -LM  00 0 00 0R 0 0 0 0 0 K -L M  0K 00S00 00 0 K -LM8 0(0 0 0 8O0,0 ,0S0<8 00K,0Sw 000S 000<8 00,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 t0(0 (0S,,0<8 ( t(0,!0S (},X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CTO00 0S;0 0 ~00 0 S;0  B>K 0C0C,0w00 0S 0 0 #>K 0C0C-` B>K 0C0C0<0 0R 0 0  >K 0C0CI0 0b0 0S>K 0C0C00$0 (0 (00S0 0 >K 0C0C'(0 >K 0C0C  0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00(00S (00( 0<8 <8 K Tp tx\lX `|DP -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   0q0S00 00 0 K -L M  00S 00S00 300 000S00 )0 00000;S 00>@0090T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )0 00000;S 00@000T 00 0 00R 00 000 000 0K -LM $ 000 0 0HPL -L Mp000 0 \0 0 P000S00  00S00 0 KLH -L M $00  000 K -L M 00 000 ,000 000 0S! K -L M, 00 200 00=S000 000 00S001=0$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S 0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c000 0!$000S$m, 00000 9 0!$00 00c 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00K` -L M, 00 X20$0 H20 0 $0 000S 00 0 $0R000 $00$0 $0S001p0(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 00e0S2 00 0 $0R$00000 0!(0@0,000!(000S(, 00000 0!(00 $00000 $00$0 $0S, (00000 00KP -L M  00<S+20&0s 00 20l0s 00 20t0s 00 T20;0s{ 00 00&S620&0s 00 x10a0s 00 m10m0s 00 b10p0s 00 Wh10;0s@ 00 L00>S+,10&0s 00 =10g0s 00 200t0s 00 '00;z0s 00 00 p00l0s 00 000 0S00 00C0 RI00 0 Kh -LM  000 -L M  K00"S6X10&40s 00 H,10#)0s 00 =1030s 00 20040s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 R00 0 Kh -LM 00 -LM  0St<<<<X00 p00l T00T 0S 0000 00} K,h8L` -LM  tQ00 0S0$0   00S 30$0 .0$0 $0 Kl -LM  t)00 0S0$0   070S  0$0 0$0 $0 Kp -LM  00 0S0$0  .0S0$0  00   0R 0$0 0$0 $0 Kt -LM  00 0S0$0  0S0$0  00   0R 0$0 0$0 $0 Kt -LM 0S $000 000 0 K( -LM04 8" 02K00  o00 0S(02KT02K>0$0 02[(2K82S 42S ?K048"^00 82(0K K0  @0*00 k K! -L,M03K0(0  100 0S040 /(K00 0]00 0S D040 $0KR02K3[02KT0 0 $0K 0s(040 040 40 K -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,.K 0K0  000 0S >K,0 Kl -L(M $ ( ,0 (0K0 00 $ 00 0S000 0 v, K000{0s000 000 00 K -LM   0 0000 00 K -LM   0 0000 00 K  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T:@-@3/0@Ds--Jtext/plain{"success":"false"}{"success":"true"0,"server":"%s","dev_id":"%d","sort_enable":"%d","name":"%s","mask":"%d"SERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1utf-8gb2312q{ ؋ H  7 8 oooX$(,048<@DHLPTX\`dhl$GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' 0/ 77oXX Do @S  \ 88  e؋ ` kpp0kqy wy}́h44|4pBRlpc3250/usr/www/cgi-bin/syscfg.cgi0000777000175100017510000011405413635025736014651 0ustar 10011001ELFa(<44 (4440 ((( Qtd/lib/ld-linux.so.2GNU%B$@ :=,+;>A#'78 3<52-/9 " (&!.1%*0 64?)؋f  4 o,2 89DP\ht8 AȑȌ0ԌvPNI(4"@L]XdpW|0b.0č '4WЍi܍C 0$0k libiconv.so.2__gmon_start___Jv_RegisterClasses_finilibiconv__data_startlibiconv_closelibiconv_open_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadatofatoistrchrfprintfsendtosleepstrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0{ii ii ii #đ0346     $(,048<@DHLPTX\` d!h"l#p&t'x(|)*+,-.024789:;<=?@--ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ$  --0-[tx-00 0SYhX0p@-0SpH H0`0bC1@C8P 0S :0 p8 <- -0S0S3/- -L{M>K.?>K!>K>K$>K`.00 0S~d01 ^01 1 K$ -LM 20 @ 1K50K! 0Ka 50K o0K` j 50K  080 0K``01K00\\ 0yK00D< 0q KK00$ 0h KK00 00K 00 000 000 000 000 40 000 80 000 0 00000 00KlPt|$ -LhMp 1K K K00 0A 00p 1$0Kh 5$0p0 000 40 000 80 000 0 000$0K $0p0 000 40 000 80 000 0 000e0KA (e0KL@ p0 e0K@@0dp0 K -L M( D2 K KK00( 000( 1 KK00 000( 10K 00( 10K 00( 10K 00( 10Kt 00( 10KT 00( 10K4 00( 10K |00( 10S(0 !0S(0 !0K c0(0 000 40 000 80 000 0 0000 K  ,<HT\dp -LM 2K2,K18K1hK KK00 000 0, KK00 000 08 KK00` 000 0h KK000 000 0~00 0K  0000 K90K } 000E? K+0K o 000U? K0Kh a 000e? K0 K $0< -L M0( , $0K0$0K,00 0}S000 ?000 000 00 00 0 0 0B ,000>000 000S  (0 000000 00 $0[0$0K 00 0 0R0S  (0 000$0[0$0K$0[0 0  (0 00 00 0 0?S( $0[00K -LM00K0[/S0[9S0[00C0 >0[A0C%S7ꤛțԛțԛ 00  00 00 00 00 00 00 0 K -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(400 0S 0 4R4030+30?0 3 00#3030;0SH |30;00 = 00000 000 0 00000:S0S 0 2 200 000 00S 0 00000:S 0 ;[00 0S 0K` 0 L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 0030 0 0S \000 00 U000 00 KPDT`lt|ptXhԑ(,8xTHTd\tL0`4d@ -LM   0 00S 00 K( -L M00S00 '0000 0S00 x00 p000 P00R 00 40000 00 0 Kx` -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$00 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 Kx` -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C '70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX)00 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C (0S (0$ KP$!0 0 0S  Q=K 0C000 0 00S 00Q-K B(0S (0 00(0 0S 0 0 00Sc 0 008( 0 000S" 00  00a=K 0C000 0 0 0S= 0 0a-K Bq=K 0C000 0 00S& 00q-K BA>K 0C 0C{000 0 00S 0 A>K 0C 0Cp 00 :KP? 0S) 00S 00@ 00S 008 0 0S 0 00 00S 00( 00S 00 (0S (00S A>K 0C 0C)0*KP4KP4 K xL -LM x 00 0s00 0S 00 00 0 K  -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0Cq0S B>K 0C0C0 0 00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D80080 !00S 80 40R000 40040 4002000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D80080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0H$00L4S L$0000S 0H4S H$00,0P4 P4 K蠚 -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S "0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S 0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000蜖x -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,00@0 Q0$0 $0S,0 00 0@0 |, $0 0 $0 $000 $0 30 $0 $0 0S ,000$0@0 Y$0 000 $0 $00S,000$0 0$0@0 <$0 000 $0 $00S,000$0 0$00$0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 KL -L,M( , 0 0 0 00 00 00 0000$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 KP -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 KP -LM200 #000 00000 000000S 000000 0S\10SK P10D10}810y,10u 10q10m10i00e00a00]00Y00U00Q00M00I00E00A00=x009 00 00 KL@Pl|ptXhԑT -LM  9 00 0S< 0$0  020$0 $0 K( -L M $ ( 00  00 0S$ 0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 00 (00CR0,0 0,0 ,0 K( -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 00v0 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "=00 0S 000 0 00T 0 00S 0 0  000 0 0 K$ -LM  $0 00 0S 0(0  0000 0S 0(0 $ 000(0 (0 K -LM 0S 00 0000 0 K -LM  00 0S< 0$0  00$0 $0 K( -L$M, 0 00 ,0 0 0S 000 0 0 0S0010$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00L000 0!$0@0i000!$000S$0 00040 '0!$00 0000!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!jC/K00!1 K( -LDM0 4 8 <0 $0K$ 800(0 (0K0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40Kdؑx -LM 00  d -LM  00 0p Kd -LM 00  ad -LAMM  700 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C0U0 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4   0$4 $4 K  Pl|ptXhԑT\xL -LM  00 0 00 0R 0 0 0 0 0 K -L M  0K 00S00 00 0 K -LM8 0(0 0 0 80,0 ,0S0<8 00K,0Sw 000S 00t0<8 00n,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 0(0 (0S,,0<8 ( (0,!0S (,X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CT00 0S;0 0 ~00 0 S;0  B>K 0C0C,000 0S 0 0 y>K 0C0C` B>K 0C0C00 0R 0 0 b>K 0C0ClI0 0b0 0SS>K 0C0CW00z0 (0 (00S0 0 >K 0C0CJ'(0 >K 0C0CD _0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00(00S (00( 0<8 <8 K$ Pl|ptXhԑT\x@L -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   00S00 00 0 K -L M  00S 00S00 300 000S00 )Q0 00000;S 00@000T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )0 00000;S 00R@00M0T 00 0 00R 00 000 000 0K -LM $ 000 0 0DLH -L Mp000 0 \0 0 P000S00  00S00 0 KHD -L M $00  000 K  -L M 00 000 000 000 0Sw K -L M, 00 200 00=S000 000 00S0010$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S 70 00000:S00 000 00S 00=S 0R8 0!$0@ 00c0D00 0!$000S$m, 00000 9 0!$00 00c 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00K\ -L M, 00 X20$0 H20 0 $0 000S 00 0 $0R000 $00$0 $0S0010(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 000S2 00 0 $0R$00e000 0!(0@0000!(000S(, 00000 0!(00 $00I000 $00$0 $0S, (00000 00KL -L M  00<S+20&\0s 00 20lQ0s 00 20tF0s 00 T20;;0s{ 00 00&S620&,0s 00 x10a!0s 00 m10m0s 00 b10p 0s 00 Wh10;0s@ 00 L00>S+,10&0s 00 =10g0s 00 200t0s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 RI00 0 Kd -LM b000 -L M  K00"S6X10&0s 00 H,10#0s 00 =103t0s 00 2004i0s 00 '00;^0s 00 00 p00P0s 00 000 0S00 00C0 R00 0 Kd -LM 00 -LM  0S00 p00l T00T 0S 0000 00} K4 d@ T h  -LM  t00 0S0$0   00S 0$0 0$0 $0 Kt  -LM  t00 0S0$0   00S a0$0 \0$0 $0 Kx  -LM   00 0S0$0  0S0$0  &00   0R Q0$0 L0$0 $0 K|  -LM  00 0S0$0  P0S0$0  00   0R 0$0 0$0 $0 K|  -LM 0S $000 000 0 K$ -LM04 8" 02K00  00 0S(02K02K0$0 02[(2K82S 42S ?K048"00 82(0K K0  @000  K!  -L,M03K0(0  00 0S040 /(K00 000 0S 040 $0K02K3[R02KT<0 0 $0K t0s~040 040 40 K  -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,.K 0K0  0600 0S >K,0 Kl -L(M $ ( ,0 (0K0 00 $ 00 0S000 0 , K0000s000 000 00 K -LM   0 0000 00 K   -LM   0 0000 00 K    10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T:d@-@3/0@Ds--/var/cfg_event012345648<@DHL48namedescsys_enabledauto_broadcastampdevbdelay48<@video_devscr_timeoff_delaypro_type48<@audio_ampmic_ampaudio_volaudio_bassaudio_treblemic_treblemic_bassmic_volbrd_volaudio_keepmic_keep789101148<@DHL|48<48<@48<check_bitdata_bitstop_bitbaund_rateopen_cmdclose_cmdvideo_cmdvga_cmdSERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1utf-8gb2312q{ H  - ooo:ċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċ,048<@DHLPTX\`dhlpt$ , GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH'  / -7o:: Do @S  \   e `ċ xk<<uq w   ȑȑh00|0p>Nlpc3250/usr/www/cgi-bin/relogin.cgi0000777000175100017510000007363413635025736015022 0ustar 10011001ELFa(Њ4s4 (444nnppp\ ppp((( Qtd/lib/ld-linux.so.2GNU%0.)+,/# %*&! "(  '$ -DuP  h0t2 F_Xȉ8qԉpq n(\z~\z+4&@LX7dpdq|\zq\zq} ]q?ĊE libiconv.so.2__gmon_start___Jv_RegisterClasses_fini__data_start_initlibm.so.6libc.so.6_IO_stdin_usedstrcpysprintf_IO_putcfopenstrncpyunlinkreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetstdoutmemcpyfclosemallocgetenv__ctype_b_locfwritefreadatofatoistrchrfprintfstrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0Uii ii ii |qq%q'ppqqq qq q q q q $q(q,q0q4q8qK 0C0C0 >K 0C0C '70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CXR00 00 0(4K( KK L L00 0-0$0 $0S 0S .A>K 0C 0C5(0S (0$ KP$A0 0 0S  Q=K 0C0000 0 00S 00Q-K B (0S (0 00(0 0S 0 0 00Sc 0 008( 0 000S" 00  00a=K 0C000 0 0 0S= 0 0a-K Bq=K 0C000 0 00S& 00q-K BA>K 0C 0C000 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00o 00S 00g 0 0S 0 0_ 00S 00W 00S 00O M(0S (0G0S KA>K 0C 0CR0*KP4KP4 K (vtq -LM x + 00 0s00 4 0S  00 00 0 K -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D80080 !00S 80 40R000 40040 400v000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D80080 00S 80 40R000 40040 4009000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0H$00L4S L$0000S 0H4S H$00,0P4 P4 KPz -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S N0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S (0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S 0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 %0 0[000:S0K( 0K( Y0S 0S 0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000Lv(v -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,0I0@0 q0$0 $0S,0<0090@0 |, $0 0 $0 $00;0 $0 S0 $0 $0 0S ,000$0@0 Y$0 00:0 $0 $00S,000$0 0$0@0 <$0 000 $0 $00S,000$0 0$00$0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 Kq -L,M( , 0 0 0 00 00 00 0000$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 Kr -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 Kr -LM200 #000 00000 000000S 000000 0S\10SK P10D10810,10 10101000000000000000|00x00t00p00lx00h 00 00 Kqqv@v0vv4vTzHv,v vLv$v8vvvK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!C/K00!1 K -LDM0 4 8 <0 $0K$ 800(0 (0K0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40Kvqq( -LM 00  v -LM  00 0 Kv -LM 00  v -LAMM  `00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C0u0 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S00$4 + 50$4 $4 Kv@v0vv4vTzHv,v vLv$v8vvvK 0C0C0S 0 0 >K 0C0CT00 0S;0 0 ~00 0 S;0  B>K 0C0C,000 0S 0 0 >K 0C0C` B>K 0C0C00 0R 0 0 >K 0C0CI0 0b0 0S>K 0C0C000 (0 (00S0 0 >K 0C0Cs'(0 >K 0C0Cm 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,;(0S) (00S (00'(00S (00(0 0S (0 0(00S (00(00S (00( 0<8 <8 Kv@v0vv4vTzHv,v vLv$v8vvvS+,10&0s 00 =10g0s 00 200t0s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 RI00 0 Kv -LM 000 -L M  K00"S6X10&0s 00 H,10#0s 00 =1030s 00 2004z0s 00 '00;o0s 00 00 p00a0s 00 000 0S00 00C0 R00 0 Kv -LM 00  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T:@-@3/0@Dso--Status: 401 Unauthorized WWW-Authenticate: Basic realm="Enter your password:" Unauthorized SERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 KU  H  poooZp000000000000000000000000000000000Pv  $GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH\' /7oZZ`Do@S \  e `00 kЊ `qk wkHnppppppppppqq`qq|qprrlpc3250/usr/www/cgi-bin/playerctrlset.cgi0000777000175100017510000010377413635025736016257 0ustar 10011001ELFa(h44 (444zz  ((( Qtd/lib/ld-linux.so.2GNU%>"< 69)(7:=!%34 081/*,5   $+#'- 2.;&4@L  dup|I2 _ċЋ܋|f_ 8 n$P0*<#HT`lux  pk+^|̌، <   $1C ,8eD P\E  libiconv.so.2__gmon_start___Jv_RegisterClasses_fini__data_start_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0Uii ii ii  0$2     $(,048<@DHLPTX\` d!h$l%p&t'x(|)*+-/3456789;<--uƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌL$  --0-gp|t-00 0SeK 0C0C0 >K 0C0C 'p70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX00 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C(0S (0$ KP$0 0 0S  Q=K 0C000 0 00S 00Q-K B(0S (0 00(0 0S 0 0 00Sc 0 00k8( 0 000S" 00  00a=K 0C]00}0 0 0 0S= 0 0a-K BSq=K 0CF00f0 0 00S& 00q-K BK 0C 0C.00N0 0 00S 0 A>K 0C 0C# 00 :KP? 0S) 00S 00 00S 00 0 0S 0 0 00S 00 00S 00 (0S (00S A>K 0C 0C0*KP4KP4 K h(8D< -LM x 00 0s00 0S 00 00 0 KH -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C*0S B>K 0C0C0 0 e00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00Du80080 !00S 80 40R000 40040 400000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D880080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000p000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0}H$00L4S L$0000S 0oH4S H$00,0P4 P4 K X -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 @0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S 0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S {0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000h -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,00@0 0$0 $0S,0000@0 |, $0 0 $0 $000 $0 0 $0 $0 0S ,000$0@0 Y$0 000 $0 $00S,000$0 0$0@0 <$0 000 $0 $00S,0l00i$0 0e$00a$_0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 K< -L,M( , 0 0 0 00 00 00 000^0$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 K@ -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 K@ -LM200 #000 00_00[0 0W00S000S 00b00FD00 0S\10SK P107D103810/,10+ 10'10#100000000000 000000000000x00 00 00 K<0@p\t l`dxHX|D  -LM  9 00 0S< 0$0  020$0 $0 Kd -L M $ ( 00  00 0S$ 0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 00 (00CR0,0 0,0 ,0 Kd -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 00)0 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "00 0S 000 0 00T 0 00S 0 0  000 0 0 K` -LM  $0 00 0S 0(0  0000 0S 0(0 $ 000(0 (0 K -LM 0S 00 00gY00 0 K -LM  00 0S< P0$0  00$0 $0 Kd -L$M, 0 00 ,0 0 0S 000 0 0 0S001K0$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00000 0!$0@0000!$000S$0 00040 '0!$00 000!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!#C/K00!1 Kd -LDM0 4 8 <0 $0Ks$ 800(0 (0K~0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40AKT -LM 00  0T -LM  00 0 KT -LM 00  T4 -LAMM  00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C00 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4  0$4 $4 KLP@p\t l`dxHX|D Lh< -LM  00 0 00 0R 0 0 0 0 0 K -L M  0K 00S00 00 0 K -LM8 0(0 0 0 8X0,0 ,0S0<8 00K,0Sw 000S 00*0<8 00$,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 0(0 (0S,,0<8 ( (0,!0S (,X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CTX00 0S;0 0 ~00 0 S;0  B>K 0C0C,0z00 0S 0 0 />K 0C0C6` B>K 0C0C0B0 0R 0 0 >K 0C0CI0 0b0 0S >K 0C0C 00*0 (0 (00S0 0 >K 0C0C'(0 >K 0C0C 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00(00S (00( 0<8 <8 K`P@p\t l`dxHX|D Lh0D< -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   0t0S00 00 0 K -L M  00S 00S00 300 000S00 )0 00000;S 00A@00<0T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )0 00000;S 00@000T 00 0 00R 00 000 000 0K -LM $ 000 0 04<8 -L Mp000 0 \0 0 P000S00  00S00 0 K84 -L M $00  000 KX -L M 00 000 8000 000 0S- K -L M, 00 200 00=S000 000 00S001C0$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S 0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c000 0!$000S$m, 00000 9 0!$00 00c 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00KL -L M, 00 X20$0 H20 0 $0 000S 00 0 $0R000 $00$0 $0S001v0(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 00h0S2 00 0 $0R$00000 0!(0@02000!(000S(, 00000 0!(00 $00000 $00$0 $0S, (00000 00K< -L M  00<S+20& 0s 00 20l0s 00 20t0s 00 T20;0s{ 00 00&S620&0s 00 x10a0s 00 m10m0s 00 b10p0s 00 Wh10;0s@ 00 L00>S+,10&0s 00 =10g0s 00 200t0s 00 '00;}0s 00 00 p00o0s 00 000 0S00 00C0 RI00 0 KT -LM 000 -L M  K00"S6X10&70s 00 H,10#,0s 00 =103!0s 00 20040s 00 '00; 0s 00 00 p000s 00 000 0S00 00C0 R00 0 KT -LM 00 -LM  0S`((((D00 p00l T00T 0S 0000 00} KpT| -LM  tZ00 0S0$0   00S ?0$0 :0$0 $0 K -LM  t200 0S0$0   0=0S 0$0 0$0 $0 K -LM  00 0S0$0  10S0$0  00   0R 0$0 0$0 $0 K -LM  00 0S0$0  0S0$0  00   0R 0$0 0$0 $0 K -LM 0S $000 000 0 K -LM04 8" 02K00  {00 0S(02Kc02KM0$0 02[(2K82S 42S ?K048"g00 82(0K K0  @0900 q K! -L,M03K0(0  =00 0S040 /(K00 0c00 0S J040 $0KX02K3[ 02KT0 0 $0K '0s.040 040 40 K -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,.K 0K0  000 0S >K,0 Kl  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T:h @-@3/0@Ds--brdCtrlline1InputmicInputmp3PlayCtrlmp3FileChangedirIdfileIdtext/plainsuccessSERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1KU H܂  x|o<oo hlptx|`hGCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' ܂/7o|Do<< @S || \  x e ` Hkhh iqw wwzh  | p lpc3250/usr/www/cgi-bin/reboot.cgi0000777000175100017510000010400013635025736014633 0ustar 10011001ELFa(44 (444xx$ ((( Qtd/lib/ld-linux.so.2GNU%?#= 7:*)8;>"&45 1920+-6  !% ,$(. 3/<'Xdp  |I2p ċ^Ћ܋f |$m0_|<8H$nTP`*l#xu  wř،+e$<  $ (1,C8DP\hlt$E0 libiconv.so.2__gmon_start___Jv_RegisterClasses_fini__data_start_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locsystemfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0Uii ii ii $1(3     $(,048<@DHLPTX\` d!h"l%p&t'x(|)*+,.0456789:<=--uƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ $  --0-d܎-00 0Sb sX0p@-0SpH H0`0bC1@C8P 0S :0 p, 0- -0S0S3/- -L^ @0 -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(400 0S ,0 4R40+30+30?0 3 00#3030;0SH |30;00 = 00000 000 0 00000:S0S 0 2 200 000 00S 0 00000:S 0 ;00 0S 0K` 0 L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 00Z0 0 0S \000 00 U000 00 KDt`x pd h|(L4\@L\ lp|lH P@$T(X4 -LM   0 00S 00 Kl -L M00S00 '00 00 0S00 x00 p000 P00R 00 40000 00 0 KlT -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$00 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 KlT -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C '70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CXP00 00 0(4K( KK L L00 0-0$0 $0S 0S ,A>K 0C 0C3(0S (0$ KP$E0 0 0S  Q=K 0C0040 0 00S 00Q-K B (0S (0 00(0 0S 0 0 00Sc 0 008( 0 000S" 00  00a=K 0C000 0 0 0S= 0 0a-K Bq=K 0C000 0 00S& 00q-K BA>K 0C 0C000 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00j 00S 00b 0 0S 0 0Z 00S 00R 00S 00J H(0S (0B0S IA>K 0C 0CP0*KP4KP4 K l$0@L@ -LM x )00 0s00 80S 00 00 0 KP -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D80080 !00S 80 40R000 40040 400\000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D80080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0H$00L4S L$0000S 0H4S H$00,0P4 P4 K ` -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S L0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S &0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S 0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 #0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000l -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,0D0@0 u0$0 $0S,070040@0 |, $0 0 $0 $0090 $0 W0 $0 $0 0S ,000$0@0 Y$0 00>0 $0 $00S,000$0 0$0@0 <$0 00!0 $0 $00S,000$0 0$00$0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 K@ -L,M( , 0 0 0 00 00 00 0000$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 KD -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 KD -LM200 #000 00000 000000S 000000 0S\10SK P10D10810,10 101010000000000000{00w00s00o00k00gx00c 00 00 K@4Dt`x pdh|L\H  -LM  9 00 0S< C0$0  020$0 $0 Kl -L M $ ( 00  00 0S$ 0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 00 (00CR0,0 0,0 ,0 Kl -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 000 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "a00 0S 000 0 00T0 0 00S 0 0  000 0 0 Kh -LM  $0 00 0S 0(0  00=00 0S 0(0 $ 000(0 (0 K -LM 0S 00 0000 0 K -LM  00 0S< 0$0  00$0 $0 Kl -L$M, 0 00 ,0 0 0S 000 0 0 0S0010$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00s000 0!$0@0000!$000S$0 00040 '0!$00 00W0!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!C/K00!1 Kl -LDM0 4 8 <0 $0K$ 800(0 (0K0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40KX -LM 00  X -LM  00 0 KX( -LM 00  X< -LAMM  ^00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C0y0 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S.0$4 ) 30$4 $4 KTXDt`x pdh|L\H Pl@ -LM  00 0 00 0R 0 0 0 0 0 K -L M  0K 00S00 00 0 K -LM8 0(0 0 0 80,0 ,0S0<8 00K,0Sw 000S 000<8 00,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 0(0 (0S,,0<8 ( (0,!0S (,X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CT00 0S;0 0 ~00 0 S;0  B>K 0C0C,000 0S 0 0 >K 0C0C` B>K 0C0C00 0R 0 0 >K 0C0CI0 0b0 0S}>K 0C0C~000 (0 (00S0 0 >K 0C0Cq'(0 >K 0C0Ck 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,9(0S) (00S (00"(00S (00(0 0S (0 0(00S (00 (00S (00( 0<8 <8 KhXDt`x pdh|L\H Pl4L@ -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   00S00 00 0 K -L M  00S 00S00 300 000S00 ){0 00000;S 00@000T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )90 00000;S 00s@00n0T 00 0 00R 00 000 000 0K -LM $ 000 0 08@< -L Mp000 0 \0 0 P0010S00  00S00 0 K<8 -L M $00  000 K` -L M 00 000 000 000 0S K -L M, 00 200 00=S000 000 00S0010$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S a0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c0h00 0!$000S$m, 00000 9 0!$00 00c $ 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00KP -L M, 00 X20$0 H20 0 $0 00 0S 00 0 $0R000 $00$0 $0S0010(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 000S2 00 0 $0R$00000 0!(0@0000!(000S(, 00000 0!(00 $00p000 $00$0 $0S, (00000 00K@ -L M  00<S+20&}0s 00 20lr0s 00 20tg0s 00 T20;\0s{ 00 00&S620&M0s 00 x10aB0s 00 m10m70s 00 b10p,0s 00 Wh10;!0s@ 00 L00>S+,10&0s 00 =10g0s 00 200t0s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 RI00 0 KX -LM 000 -L M  K00"S6X10&0s 00 H,10#0s 00 =1030s 00 20040s 00 '00;0s 00 00 p00q0s 00 000 0S00 00C0 R00 0 KX -LM 00 -LM  0S00  p00l T00T 0S 0000 00} KxX -LM  t00 0S0$0   00S 0$0 0$0 $0 K -LM  t00 0S0$0   00S 0$0 0$0 $0 K -LM  600 0S0$0  0S0$0  P00   0R u0$0 p0$0 $0 K -LM  00 0S0$0  q0S0$0   00   0R A0$0 <0$0 $0 K -LM 0S $000 000 0 K -LM04 8" 02K00  00 0S(02K02K0$0 02[(2K82S 42S ?K048"00 82(0K K0  @000  K! -L,M03K0(0  00 0S040 /(K00 000 0S 040 $0K02K3[02KTf0 0 $0K 0s040 040 40 K -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,,.K 0K0  0Z00 0S >K,0 Kl  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T: @-@3/0@Ds-- rebootSERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1KU 0 pHІ  oXoo؈DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDptx|hpGCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' /І7o؈~DoXX @S  \   e00 `DD Tk gqppu w||udxh$$|$p!lpc3250/usr/www/cgi-bin/getmusic.cgi0000777000175100017510000007364413635025736015204 0ustar 10011001ELFa(04s4 (444oopppd ppp((( Qtd/lib/ld-linux.so.2GNU%20+ -! .1% ',(#"$*  )&/u  <ȉԉ2\ R_hd(8q4|q@LXdp|ndzdz72%CĊЊpq ܊dzqdzq}, iqK$Ed libiconv.so.2__gmon_start___Jv_RegisterClasses_fini__data_start_initlibm.so.6libc.so.6_IO_stdin_usedstrcpysprintf_IO_putcfopenstrncpyunlinkreallocabortstdintolowerstrspnchmodmkstempgmtimefgetscallocstrlenmemsetstdoutfputsmemcpyfclosemallocgetenv__ctype_b_locfwritefreadatofatoistrchrfprintfstrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0Uii ii ii qq'q)ppqqq qqq q q q $q(q,q0q4q8qKK R0S\00X xD00D r,000 l0 Klv -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(400 0S 0 4R4030+30?0 3 00#3030;0SH |30;00 = 00000 000 0 00000:S0S 0 2 200 000 00S 0 00000:S 0 ;}00 0S 0K` 0 L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 00=0 0 0S \000 00 U000 00 KvHv8v$vK 0C0C0 >K 0C0C '70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX300 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C(0S (0$ KP$"0 0 0S  Q=K 0C000 0 00S 00Q-K B(0S (0 00(0 0S 0 0 00Sc 0 008( 0 000S" 00  00a=K 0C000 0 0 0S= 0 0a-K Bq=K 0C000 0 00S& 00q-K BA>K 0C 0C000 0 00S 0 A>K 0C 0Cz 00 :KP? 0S) 00S 00P 00S 00H 0 0S 0 0@ 00S 008 00S 000 .(0S (0(0S ,A>K 0C 0C30*KP4KP4 K 0v 4<HXdr -LM x 00 0s00 0S 00 00 0 Kh -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D80080 !00S 80 40R000 40040 400T000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D}80080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0H$00L4S L$0000S 0H4S H$00,0P4 P4 KXzx -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S /0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S 0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000Tv0v -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,0*0@0 R0$0 $0S,0000@0 |, $0 0 $0 $000 $0 40 $0 $0 0S ,000$0@0 Y$0 000 $0 $00S,000$0 0$0@0 <$0 000 $0 $00S,000$0 0$00$0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 Kr -L,M( , 0 0 0 00 00 00 0000$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 Kr -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 Kr -LM200 #000 00000 000000S 000000 0S\10SK P10D10810,10 1010}10y00u00q00m00i00e00a00]00Y00U00Q00Mx00I 00 00 KrqvHv8v$v00 0S 000 0 00T 0 00S 0 0  000 0 0 K -LM  $0 00 0S 0(0  0000 0S 0(0 $ 000(0 (0 K -LM 0S 00 0000 0 K -LM  00 0S< 0$0  00$0 $0 K -L$M, 0 00 ,0 0 0S 000 0 0 0S0010$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00V000 0!$0@0j000!$000S$0 00040 '0!$00 00:0!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!C/K00!1 K -LDM0 4 8 <0 $0K$ 800(0 (0K0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40Kvqq -LM 00  v, -LM  00 0q Kv@ -LM 00  bvT -LAMM  A00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C0V0 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4  0$4 $4 KlpvHv8v$vK 0C0C0S 0 0 >K 0C0CT00 0S;0 0 ~00 0 S;0  B>K 0C0C,000 0S 0 0 >K 0C0C` B>K 0C0C00 0R 0 0 o>K 0C0CvI0 0b0 0S`>K 0C0Ca00{0 (0 (00S0 0 >K 0C0CT'(0 >K 0C0CN `0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00(00S (00( 0<8 <8 KpvHv8v$vS+,10&0s 00 =10g0s 00 200t0s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 RI00 0 Kv -LM l000 -L M  K00"S6X10&|0s 00 H,10#q0s 00 =103f0s 00 2004[0s 00 '00;P0s 00 00 p00B0s 00 000 0S00 00C0 R00 0 Kv -LM 00  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``pa@ @00bCQ@`  @T:@-@3/0@Dso--application/json/tmp/musicInfor[ {} ] SERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 KU d \H̅  pL4ooopxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxXvGCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HHd'  /̅7odDo@S 44\ LL edd `xx k00 ,aq\\l whhloppppppppppqq`qq|qprrlpc3250/usr/www/cgi-bin/netcfg.cgi0000777000175100017510000010400013635025736014607 0ustar 10011001ELFa(44 (444zz$ ((( Qtd/lib/ld-linux.so.2GNU%?#= 7:*)8;>"&45 1920+-6  !% ,$(. 3/<'Xdp  uI2, ċЋ_܋ |$f0_8<8H$nTP`*l#xu  pǩ،+^|$<  $ (1,C8DP\het$E0 libiconv.so.2__gmon_start___Jv_RegisterClasses_fini__data_start_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainntohlfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0Uii ii ii $1(3     $(,048<@DHLPTX\` d!h"l%p&t'x(|)*+,.0456789:<=--uƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ $  --0-d-00 0Sb sX0p@-0SpH H0`0bC1@C8P 0S :0 p, 0- -0S0S3/- -LdM0S00 00 0S'(0K 80Kx H0Kh (0K"010h0 80K0)0d0 H0K0!0`0 0h0 0d0 0`0 0S00 00 0S X0K X0K00\0 0\0 h0K  100 0Sj0p0 d0p0 p0 K<HLX`h -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(400 0S 0 4R4030+30?0 3 00#3030;]0SH |30;U00 = 00000 000 z0 00000:S0S 0 2 200 000 00S Z0 00000:S 0 ;00 0S 0K` 0U L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 000 0 0S \000 h00 U000 00 KDpt`x pdh|L\(4D TXdlHt P@$T(X4 -LM  _ 0 00S 00 KT -L M00S00 '0000 0S00 x00 p000 P00R 00 40000 E00 0 KlT -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$G00 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 KlT -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C 'r70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX00 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C(0S (0$ KP$0 0 0S  Q=K 0C000 0 00S 00Q-K B(0S (0 00(0 0S 0 0 00Sc 0 00p8( 0 000S" 00  00a=K 0Cb000 0 0 0S= 0 0a-K BXq=K 0CK00k0 0 00S& 00q-K BAA>K 0C 0C300S0 0 00S 0 A>K 0C 0C( 00 :KP? 0S) 00S 00 00S 00 0 0S 0 0 00S 00 00S 00 (0S (00S A>K 0C 0C0*KP4KP4 K l (4@ -LM x 00 0s00 0S 00 00 0 K8 -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C,0S B>K 0C0C0 0 j00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00Dz80080 !00S 80 40R000 40040 400000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D=80080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000r000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0H$00L4S L$0000S 0tH4S H$00,0P4 P4 K H -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 E0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S 0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S 0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000l -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,00@0 0$0 $0S,0000@0 |, $0 0 $0 $000 $0 0 $0 $0 0S ,000$0@0 Y$0 000 $0 $00S,000$0 0$0@0 <$0 000 $0 $00S,0q00n$0 0j$00f$d0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 K@ -L,M( , 0 0 0 00 00 00 000c0$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 KD -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 KD -LM200 #000 00d00`0 0\00X000S 00g00KI00 0S\10SK P10K,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!%C/K00!1 KT -LDM0 4 8 <0 $0Kx$ 800(0 (0K0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40FKX -LM 00  5X -LM  00 0% KX -LM 00  X$ -LAMM  00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C0 0 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4  0$4 $4 K<@Dt`x pdh|L\H Pl@ -LM  00 0 00 0R 0 0 0 0 0 K -L M  0K 00S00 00 0 K -LM8 0(0 0 0 8]0,0 ,0S0<8 00K,0Sw 000S 00/0<8 00),t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 0(0 (0S,,0<8 ( (0,!0S (,X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CT]00 0S;0 0 ~00 0 S;0  B>K 0C0C,000 0S 0 0 4>K 0C0C;` B>K 0C0C0G0 0R 0 0 >K 0C0C$I0 0b0 0S>K 0C0C00/0 (0 (00S0 0 >K 0C0C'(0 >K 0C0C 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00(00S (00( 0<8 <8 KP@Dt`x pdh|L\H Pl44@ -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   0y0S00 00 0 K -L M  00S 00S00 300 000S00 ) 0 00000;S 00F@00A0T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )0 00000;S 00@000T 00 0 00R 00 000 000 0K -LM $ 000 0 08@< -L Mp000 0 \0 0 P000S00  00S00 0 K<8 -L M $00  000 KH -L M 00 000 =000 000 0S2 K -L M, 00 200 00=S000 000 00S001H0$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S 0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c000 0!$000S$m, 00000 9 0!$00 00c 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00KP -L M, 00 X20$0 H20 0 $0 000S 00 0 $0R000 $00$0 $0S001{0(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 00m0S2 00 0 $0R$00000 0!(0@07000!(000S(, 00000 0!(00 $00000 $00$0 $0S, (00000 00K@ -L M  00<S+20&0s 00 20l0s 00 20t0s 00 T20;0s{ 00 00&S620&0s 00 x10a0s 00 m10m0s 00 b10p0s 00 Wh10;0s@ 00 L00>S+,10&0s 00 =10g0s 00 200t0s 00 '00;0s 00 00 p00t0s 00 000 0S00 00C0 RI00 0 KX -LM 000 -L M  K00"S6X10&<0s 00 H,10#10s 00 =103&0s 00 20040s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 R00 0 KX -LM 00 -LM  0S|DDDD`00 p00l T00T 0S 0000 00} K`Xl -LM  t_00 0S0$0   00S D0$0 ?0$0 $0 K -LM  t700 0S0$0   0B0S 0$0 0$0 $0 K -LM  00 0S0$0  60S0$0  00   0R 0$0 0$0 $0 K -LM  00 0S0$0  0S0$0  00   0R 0$0 0$0 $0 K -LM 0S $000 000 0 K -LM04 8" 02K00  00 0S(02Kh02KO0$0 02[(2K82S 42S ?K048"l00 82(0K K0  @0;00 v K! -L,M03K0(0  B00 0S040 /(K00 0h00 0S O040 $0K]02K3[02KT0 0 $0K ,0s3040 040 40 K -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,.K 0K0  000 0S >K,0 Kl  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p @ @00bCQ@`  @T:L @-@3/0@Ds--enable_dhcpipnet_maskgatewayautoserverSERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1KU 0 ,HІ  oXoo؈DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDX\`dhlptx|PXGCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' /І7o؈~DoXX @S  \   e00 `DD Tk iq,,w w88wzh$$|$p!lpc3250/usr/www/cgi-bin/passwd.cgi0000777000175100017510000010413413635025736014652 0ustar 10011001ELFa(4L4 (444}} ((( Qtd/lib/ld-linux.so.2GNU%C%A :>-,<?B$(78 4=53.+;9 ! #'"/&*1 062@)(4  LX.dip2 |3ČЌ܌s$8 p$0J<CHT`lx  K~̍؍\ ( !Qc ,c8=DP\htE libiconv.so.2__gmon_start___Jv_RegisterClasses_fini__data_start_initlibm.so.6libcrypt.so.1cryptlibc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimefgetscallocstrlenmemsetbindfseekstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadsrandomatofatoistrchrfprintfsendtostrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.0GLIBC_2.1GLIBC_2.3U ii  iii ii ii  46   $ ( ,048<@DHLPTX\`dh l!p"t#x$|'()*+,-./13789:;<=>@A-{-tƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌP$  --0-Xx|-00 0SY,rX0p@-0SpH H0`0bC1@C8P 0S :0 p - -0S0S3/- -LlM00K P0K } p0K x 00K700 0S 00P0Kp K0S 00P0K00 0S X \000x0 0000x0 x0 K(4<HX -LM LL00 0SA  00K0K 0S3 0K00 00C K000 S00C K0 000K:00 0S  00000 0"0S00 0S  0 Kh| -L M   0? @00 0000  B# 00C0  R K -LM 00 0S0$0 0J 0K 0K 00 <004 0w0$0 $0 Kh -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(400 0S 60 4R40530+30?0 3 00#3030;0SH |30;00 = 00000 000 0 00000:S0S 0 2 200 000 00S 0 00000:S 0 ;00 0S 0K` 0 L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 00d0 0 0S \000 00 U000 00 K  ,8DP`$ pt  -LM   0 00S 00 Kp -L M00S00 '0000 0S00 x00 p00$0 P00R 00 40000 00 0 K -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$00 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 K -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C '70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CXZ00 00 0(4K( KK L L00 0-0$0 $0S 0S 6A>K 0C 0C=(0S (0$ KP$R0 0 0S  Q=K 0C00A0 0 00S 00Q-K B(0S (0 00(0 0S $0 0 00Sc 0 008( 0 000S" 00  00a=K 0C000 0 0 0S= 0 0a-K Bq=K 0C000 0 00S& 00q-K BA>K 0C 0C000 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00q 00S 00i 0 0S 0 0a 00S 00Y 00S 00Q O(0S (0I0S SA>K 0C 0CZ0*KP4KP4 K  (4DP -LM x 3"00 0s00 E 0S (00 00 0 KT -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40#000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D80080 !00S 80 40R000 40040 400c000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D80080 00S 80 40R000 40040 400&000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0H$00L4S L$0000S 0H4S H$00,0P4 P4 K d -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S S0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S -0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S 0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 *0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000 -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,0K0@0 0$0 $0S,0>00;0@0 |, $0 0 $0 $00C0 $0 d0 $0 $0 0S ,000$0@0 Y$0 00K0 $0 $00S,000$0 0$0@0 <$0 00.0 $0 $00S,000$0 0$00$0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 K -L,M( , 0 0 0 00 00 00 0000$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 K -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 K -LM200 #000 00000 000000S 000000 0S\10SK P10D10810,10 10101000000000000000~00z00v00r00nx00j 00 00 K $  -LM  9 00 0S< M0$0  020$0 $0 Kp -L M $ ( 00  00 0S$ *0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 00 (00CR0,0 0,0 ,0 Kp -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 000 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "n00 0S 000 0 00T: 0 00S 0 0  000 0 0 Kl -LM  $0 00 0S 0(0  00M00 0S 0(0 $ 000(0 (0 K -LM 0S 00 0000 0 K -LM  00 0S< 0$0  00$0 $0 Kp -L$M, 0 00 ,0 0 0S 000 0 0 0S0010$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00}000 0!$0@0000!$000S$0 00040 '0!$00 00a0!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!C/K00!1 Kp -LDM0 4 8 <0 $0K$ 800(0 (0K0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40K(D -LM 00   -LM  00 0 K, -LM 00  @ -LAMM  h00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C00 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S80$4 3 =0$4 $4 KX\ $  -LM  00 0 0$0 0R 0 0 0 0 0 K -L M  0K 0 0S00 00 0 K -LM8 0(0 0 0 80,0 ,0S0<8 00K,0Sw 000S 000<8 00,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 0(0 (0S,,#0<8 ( (0,!0S (,X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CT00 0S;0 0 ~00 0 S;0  B>K 0C0C,000 0S 0 0 >K 0C0C` B>K 0C0C00 0R 0 0 >K 0C0CI0 0b0 0S>K 0C0C000 (0 (00S0 0 >K 0C0C{'(0 >K 0C0Cu 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,C(0S) (00S (00)(00S (00!(0 0S (0 0(00S (00(00S (00 ( 0<8 <8 Kl\ $ P -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   00S00 00 0 K -L M  00S 00S00 300 000S00 )0 00000;S 00@000T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )@0 00000;S 00@00~0T 00 0 00R 00 000 000 0K -LM $ 000 0 0 -L Mp000 0 \0 0 P00A0S00  00S00 0 K -L M $00  000 Kd -L M 00 000 000 000 0S K -L M, 00 200 00=S000 000 00S0010$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S h0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c0u00 0!$000S$m, 00000 9 0!$00 00c . 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00K -L M, 00 X20$0 H20 0 $0 0000S 00 0 $0R000 $00$0 $0S0010(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 000S2 00 0 $0R$00000 0!(0@0000!(000S(, 00000 0!(00 $00z000 $00$0 $0S, (00000 00K -L M  00<S+20&0s 00 20l0s 00 20tw0s 00 T20;l0s{ 00 00&S620&]0s 00 x10aR0s 00 m10mG0s 00 b10p<0s 00 Wh10;10s@ 00 L00>S+,10&"0s 00 =10g0s 00 200t 0s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 RI00 0 K -LM 000 -L M  K00"S6X10&0s 00 H,10#0s 00 =1030s 00 20040s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 R00 0 K -LM !00 -LM  0Sh0000L00 p00l T00T 0S 0000  00} K| -LM  t00 0S0$0   0 0S 0$0 0$0 $0 K -LM  t00 0S0$0   00S 0$0 0$0 $0 K -LM  :00 0S0$0  0S0$0  W00   0R 0$0 }0$0 $0 K -LM  00 0S0$0  0S0$0  00   0R N0$0 I0$0 $0 K -LM 0S $000 000 0 Kt -LM04 8" 02K00  00 0S(02K02K0$0 02[(2K82S 42S ?K048"00 82(0K K0  @000  K! -L,M03K0(0  00 0S040 /(K00 000 0S 040 $0K02K3[02KTm0 0 $0K 0s040 040 40 K -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,3.K 0K0  0d00 0S >K,0 Kl  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T:h @-@3/0@Ds--0old_passpassconf_passconfirm_errorupdate_error/etc/boa/www.passwdrw%s:%s SERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1KUi H  ) H0oЉooJ./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyztx|ltGCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' 0/ )7oJJ DoЉ `S 00 \ HH  e ` kkqz w$$z}ԁpm}lpc3250/usr/www/cgi-bin/getplayerst.cgi0000777000175100017510000010430013635025736015707 0ustar 10011001ELFa(l44 (4444 ((( Qtd/lib/ld-linux.so.2GNU%C&A! ;>.-<?B%)89 5=64/1: $ "*(#0 ',2 73@+f  ,84DoP2 \9htȌ8Ԍ A\ĂvP(N4I@LXdp@@"|]WčЍ܍Ăb@.Ă@'ȂWi $C0<HĂT`kԋ libiconv.so.2__gmon_start___Jv_RegisterClasses_finilibiconv__data_startlibiconv_closelibiconv_open_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locioctlfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainntohlfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0{ii ii ii )XĂ5Ȃ7    āȁ́Ёԁ؁܁ !"#$%( )*+,- .$/(0,2044889<:@;D<H=L>P@TA--ƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌ$  --0-Xtx-00 0SVX0p@-0SpH H0`0bC1@C8P 0S :0 p̂Ђ- -0S0S3/䠀- -LM0$0 00 0$0 $0S4 $0K0 00  01000 0S$02 1K00$0 02 1K00 E00 00 $0 K0K0 0B0 0 0S4 $02 1K00 $00R30S4 0K$ 0S043 0 +>K$$+>K0 hd20` L2 00@ 3>K 003.K0 103.K1 00 3>K 003.K0103.K|1 00 00S3>K 0>3.K@@0103.K(1 00 0 00 0 00 0 00 0@   04080<0L0p 400` 4 43K!T$8<Pdx -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(400 0S 0 4R4030+30?0 3 00#3030;0SH |30;00 = 00000 000 0 00000:S0S 0 2 200 000 00S 0 00000:S 0 ;d00 0S 0K` 0 L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 00B0 0 0S \000 00 U000 00 K$$4@Td8p,0 h4  (<4(DTĂȂԂ`h -LM   0 00S 00 K -L M00S00 '0000 0S00 x00 p000 P00R 00 40000 00 0 K  -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$00 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 K  -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C '70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX800 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C(0S (0$ KP$00 0 0S  Q=K 0C000 0 00S 00Q-K B(0S (0 00(0 0S 0 0 00Sc 0 008( 0 000S" 00  00a=K 0C000 0 0 0S= 0 0a-K Bq=K 0C000 0 00S& 00q-K BA>K 0C 0C000 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00L 00S 00D 0 0S 0 0< 00S 004 00S 00, *(0S (0$0S .A>K 0C 0C80*KP4KP4 K   -LM x 00 0s00 #0S 00 00 0 K -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0Cz0S B>K 0C0C0 0 00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D80080 !00S 80 40R000 40040 400;000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D80080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0H$00L4S L$0000S 0H4S H$00,0P4 P4 K4 -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S 10 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S 0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 0000  -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,0&0@0 `0$0 $0S,0000@0 |, $0 0 $0 $00!0 $0 B0 $0 $0 0S ,000$0@0 Y$0 00)0 $0 $00S,000$0 0$0@0 <$0 00 0 $0 $00S,000$0 0$00$0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 K -L,M( , 0 0 0 00 00 00 0000$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 K -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 K -LM200 #000 00000 000000S 000000 0S\10SK P10D10810,10 10}10y10u00q00m00i00e00a00]00Y00U00Q00M00Ix00E 00 00 KԂ$8,0 h<( -LM  9 00 0S< +0$0  020$0 $0 K -L M $ ( 00  00 0S$ 0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 00 (00CR0,0 0,0 ,0 K -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 000 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "L00 0S 000 0 00T 0 00S 0 0  000 0 0 K -LM  $0 00 0S 0(0  00(00 0S 0(0 $ 000(0 (0 K -LM 0S 00 0000 0 K -LM  00 0S< 0$0  00$0 $0 K -L$M, 0 00 ,0 0 0S 000 0 0 0S0010$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00[000 0!$0@0x000!$000S$0 00040 '0!$00 00?0!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K 1 0 K -LEM  ! 1 C?K,!sC/K00!1 K -LDM0 4 8 <0 $0K$ 800(0 (0K0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40KlX -LM 00   -LM  00 0 K -LM 00  p -LAMM  F00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C0d0 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4  0$4 $4 K$8,0 h<(  -LM  00 0 00 0R 0 0 0 0 0 K -L M  0K 00S00 00 0 K -LM8 0(0 0 0 80,0 ,0S0<8 00K,0Sw 000S 000<8 00z,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 0(0 (0S,,0<8 ( (0,!0S (,X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CT00 0S;0 0 ~00 0 S;0  B>K 0C0C,000 0S 0 0 >K 0C0C` B>K 0C0C00 0R 0 0 q>K 0C0C{I0 0b0 0Sb>K 0C0Cf000 (0 (00S0 0 >K 0C0CY'(0 >K 0C0CS n0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00(00S (00( 0<8 <8 K$8,0 h<( Ԃ -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   00S00 00 0 K -L M  00S 00S00 300 000S00 )`0 00000;S 00@000T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )0 00000;S 00^@00Y0T 00 0 00R 00 000 000 0K -LM $ 000 0 0؂܂ -L Mp000 0 \0 0 P000S00  00S00 0 K܂؂ -L M $00  000 K -L M 00 000 000 000 0S K -L M, 00 200 00=S000 000 00S0010$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S F0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c0S00 0!$000S$m, 00000 9 0!$00 00c 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00K -L M, 00 X20$0 H20 0 $0 00 0S 00 0 $0R000 $00$0 $0S0010(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 000S2 00 0 $0R$00t000 0!(0@0000!(000S(, 00000 0!(00 $00X000 $00$0 $0S, (00000 00K -L M  00<S+20&h0s 00 20l]0s 00 20tR0s 00 T20;G0s{ 00 00&S620&80s 00 x10a-0s 00 m10m"0s 00 b10p0s 00 Wh10; 0s@ 00 L00>S+,10&0s 00 =10g0s 00 200t0s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 RI00 0 K -LM q000 -L M  K00"S6X10&0s 00 H,10#0s 00 =1030s 00 2004u0s 00 '00;j0s 00 00 p00\0s 00 000 0S00 00C0 R00 0 K -LM 00 -LM  0S00 p00l T00T 0S 0000 00} K 4H -LM  t00 0S0$0   00S 0$0 0$0 $0 KT -LM  t00 0S0$0   00S p0$0 k0$0 $0 KX -LM  00 0S0$0  0S0$0  200   0R `0$0 [0$0 $0 K\ -LM  00 0S0$0  \0S0$0  00   0R ,0$0 '0$0 $0 K\ -LM 0S $000 000 0 K踂 -LM04 8" 02K00  00 0S(02K02K0$0 02[(2K82S 42S ?K048"00 82(0K K0  @000  K!p -L,M03K0(0  00 0S040 /(K00 000 0S 040 $0K02K3[^02KTE0 0 $0K 0s040 040 40 Kp -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,.K 0K0  0E00 0S >K,0 Kl -L(M $ ( ,0 (0K0 00 $ !00 0S000 0 , K0000s000 000 00 K -LM   0 0000 00 K| -LM   0 0000 00 K|  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T:@-@3/0@Ds茀--application/json[{ "CurDirID":"%d", "CurDirName":"%s", "CurFileId":"%d", "FileName":"%s", "brdState":"%d", "sessionName":"%s", "forceBrdF":"%d", "inputLine1":"%d", "inputMic":"%d", "Mp3PlayState":"%d", "playTime":"%u", }]SERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1utf-8gb2312q{ ԋ H  3 |4o܉ooT4  $(,048<@DHLPT GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' 0/ 37oTT Do܉ @S  \ 44  eԋ ` kllmq| w |l||\\hĂĂ|Ăp҃lpc3250/usr/www/cgi-bin/recordcfg.cgi0000777000175100017510000010405413635025736015310 0ustar 10011001ELFa(<44 (444D}D}0 ((( Qtd/lib/ld-linux.so.2GNU%B%@ :=-,;>A$(78 4<53.09 # !)'"/&+1 62?*؋f  4 o,2 89DP\ht8ȌAԌ0vPNI(4@  "LX]dp|W0b .č0  '4WЍi܍C 0$0k libiconv.so.2__gmon_start___Jv_RegisterClasses_finilibiconv__data_startlibiconv_closelibiconv_open_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainntohlfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0{ii ii ii #0446     $(,048<@DHLPTX\` d!h"l#p$t'x(|)*+,-./13789:;<=?@-g-uƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ$  --0-[-00 0SYhrX0p@-0SpH H0`0bC1@C8P 0S :0 p8 <- -0S0S3/- -LxM0S00 00 0S 0W0K0V0K0U0K0T0K$$0K $0K0)0 00W0K 40 00V0K 80 00U0K 0 00T0Kx0K! x0K x KW0K0  000K  00010K(0K  (00S0K,K00 0,00R0KW0K0' 200 0Sk00 e00 0 K$ -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(4t00 0S 0 4R4030+e30?0 3 00#3030;C0SH |30;;00 = 00000 000 c0 00000:S0S 0 2 200 000 00S C0 00000:S 0 ;00 0S 0K` 0A L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 000 0 0S \000 W00 U000 00 KPl $4|@pP\tlxXh xT \L0`4d@@T -LM  E 0 00S 00 K -L M00S00 '0000 0S00 x00 p000 P00R 00 40000 .00 0 Kx` -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$600 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 Kx` -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C 'X70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX00 00 0(4K( KK L L00 0-0$0 $0S 0S A>K 0C 0C(0S (0$ KP$0 0 0S  kQ=K 0C000 0 00S 00Q-K B(0S (0 00(0 0S 0 0 00Sc 0 00Y8( 0 000S" 00  00a=K 0CN00q0 0 0 0S= 0 0a-K BDq=K 0C700Z0 0 00S& 00q-K B-A>K 0C 0C00B0 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00 00S 00 0 0S 0 0 00S 00 00S 00 (0S (00S A>K 0C 0C0*KP4KP4 K xXltL -LM x 00 0s00 |0S 00 00 0 K -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 V00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00Di80080 !00S 80 40R000 40040 400000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D,80080 00S 80 40R000 40040 400000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000X000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0kH$00L4S L$0000S 0]H4S H$00,0P4 P4 K  -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 .0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S 0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S 0 0400000S(0S $0" K0 0004004 040S 0 040000:S040=S04004 04004 040S i0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 0 0[000:S0K( 0K( Y0S 0S0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000x -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,00@0 0$0 $0S,0000@0 |, $0 0 $0 $000 $0 0 $0 $0 0S ,000$0@0 Y$0 000 $0 $00S,0w00t$0 0p$n0@0 <$0 000 $0 $00S,0Z00W$0 0S$00O$M0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 KL -L,M( , 0 0 0 00 00 00 000R0$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 KP -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 KP -LM200 #000 00M00I0 0E00A000S 00S004200 0S\10SK P10%D10!810,10 101010 00 00000000000000000000x00 00 00 KL@Pl |ptXhT  -LM  9 00 0S< 0$0  020$0 $0 K -L M $ ( 00  00 0S$ 0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 0p0 (00CR0,0 0,0 ,0 K -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 000 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "00 0S 000 0 00T 0 00S 0 0  000 0 0 K -LM  $0 00 0S 0(0  0000 0S 0(0 $ 000(0 (0 K -LM 0S 00 00UG00 0 K -LM  00 0S< A0$0  00$0 $0 K -L$M, 0 00 ,0 0 0S 000 0 0 0S001?0$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00000 0!$0@0 000!$000S$0 00040 '0!$00 000!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 000 0 0 0 0 K -LK,Y00 0S ! 10>K| 1 0 K -LEM  ! 1 C?K,! C/K00!1 K -LDM0 4 8 <0 $0Kg$ 800(0 (0Kr0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 405Kd -LM 00  $dd -LM  00 0 Kdx -LM 00  d -LAMM  00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C00 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0S0$4  0$4 $4 KPl |ptXhT \xL -LM  00 0 00 0R 0 0 0 0 0 K -L M  0K 0}0S00 00 0 K -LM8 0(0 0 0 8I0,0 ,0S0<8 00K,0Sw 00x0S 000<8 00,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 k0(0 (0S,,0<8 ( k(0,!0S (w,X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CTI00 0S;0 0 ~00 0 S;0  B>K 0C0C,0n00 0S 0 0 >K 0C0C'` B>K 0C0C060 0R 0 0 >K 0C0CI0 0b0 0S>K 0C0C000 (0 (00S0 0 >K 0C0C'(0 >K 0C0C 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,(0S) (00S (00(00S (00(0 0S (0 0(00S (00(00S (00|(z 0<8 <8 KPl |ptXhT \x@L -LM  0K00S0 0 &000 0 00S0 0 0 0 00 0R 0 0 0 0 000 0 0 K -L M   0h0S00 00 0 K -L M  00S 00S00 300 000S00 )0 00000;S 005@0000T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )0 00000;S 00@000T 00 0 00R 00 000 000 0K -LM $ 000 0 0DLH -L Mp000 0 \0 0 P000S00  00S00 0 KHD -L M $00  000 K -L M 00 000 &000 000 0S K -L M, 00 200 00=S000 000 00S00170$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S 0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c000 0!$000S$m, 00000 9 0!$00 00c 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00K\ -L M, 00 X20$0 H20 0 $0 000S 00 0 $0R000 $00$0 $0S001j0(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 00\0S2 00 0 $0R$00 000 0!(0@0&000!(000S(, 00000 0!(00 $00000 $00$0 $0S, (00000 00KL -L M  00<S+20&0s 00 20l0s 00 20t0s 00 T20;0s{ 00 00&S620&0s 00 x10a0s 00 m10m0s 00 b10p0s 00 Wh10;0s@ 00 L00>S+,10&0s 00 =10g0s 00 200t|0s 00 '00;q0s 00 00 p00c0s 00 000 0S00 00C0 RI00 0 Kd -LM 000 -L M  K00"S6X10&+0s 00 H,10# 0s 00 =1030s 00 2004 0s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 R00 0 Kd -LM 00 -LM  0Sd,,,,H00 p00l T00T 0S 0000 00} Kd -LM  tK00 0S0$0   0z0S -0$0 (0$0 $0 K -LM  t#00 0S0$0   010S 0$0 0$0 $0 K -LM  00 0S0$0  %0S0$0  00   0R 0$0 0$0 $0 K -LM  y00 0S0$0  0S0$0  ~00   0R 0$0 0$0 $0 K -LM 0S $000 000 0 K$ -LM04 8" 02K00  i00 0S(02KN02K50$0 02[(2K82S 42S ?K048"X00 82(0K K0  @0!00 e K!$ -L,M03K0(0  +00 0S040 /(K00 0W00 0S >040 $0KL02K3[02KT0 0 $0K 0s"040 040 40 K$ -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,.K 0K0  000 0S >K,0x Kl -L(M $ ( ,0 (0K0 00 $ 00 0S000 0 m, K000u0s000 000 00 K -LM   0 0000 00 K08 -LM   0 0000 00 K80  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``p@ @00bCQ@`  @T:@-@3/0@Ds--AautoipnamemaskdeviceIdsort_enabledSERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1utf-8gb2312q{ H  - ooo:ċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċċGCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH'  / -7o:: Do @S  \   e `ċ xk<<Tkqy wy@@}ȁh00|0p>Nlpc3250/usr/www/cgi-bin/getsys.cgi0000777000175100017510000010620013635025736014663 0ustar 10011001ELFa( 4p4 (444XXXXX, lll((( Qtd/lib/ld-linux.so.2GNU%A$? 9<,+:=@#'67 3;42-/8 " (&!.%*0 51>)f̋  4o2l 9 ,8DP\ht8xAvPȌNԌI"(]4@LWXdp|b.'WičCЍ܍k libiconv.so.2__gmon_start___Jv_RegisterClasses_finilibiconv__data_startlibiconv_closelibiconv_open_initlibm.so.6libc.so.6_IO_stdin_usedsocketstrcpyhtonssprintf_IO_putcfopenstrncpyunlinkselectreallocabortstdintolowerstrspnchmodmkstempgmtimecallocstrlenmemsetbindstdoutfputcrecvinet_addrlseekmemcpyfclosesetsockoptmallocbzerogetenv__ctype_b_locfwritefreadatofatoistrchrfprintfsendtostrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.1GLIBC_2.3GLIBC_2.0{ii  ii ii 35PTX\`dhl p t x | !"ą#ȅ&̅'Ѕ(ԅ)؅*܅+,-.026789:; <>?--ƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ $  --0-^\-00 0S\X0p@-0SpH H0`0bC1@C8P 0S :0 p茆`d- -0S0S3/h- -L{M>K.Y00 0S00| z>K>K>KD00}x01 01 1 K| -LM 10K! 0Ka 01 K  00 0 K``0101 K=00 K70@000 ,0@000 !0 00 `0 00d @0 04080<0( K踊 -LLMX M0KA X00M K@@00 X01 00M K0X 04080<0` H0X 04080<0$ X^ K踊0DX -LM 1 01  0 01 0 01 0 01 0 01 |0 01 z\0 01d r<0 01H j0 01, b鸊l -LM 1 00| Jl1 00` BL1 00D :,1 00( 2 1 00  *00A00"*0 01 0E?000"0 0T1 0U?T00"@0 01L 0e?00"鸊,@Th -L M 000K0 0K D0 [000, 0[0 0K [0[R K踊 -L$M( ,  ppRllOhhLddI``F\\CXX@TT=PP:LL7HH4DD1@@.<<+88(4400 0S f0 4R40e30+%30?0 3 00#3030;0SH |30;00 = 00000 000 0 00000:S0S 0 2 200 000 00S 0 00000:S 0 ;00 0S 0K` 0 L2 HHDD@@<<8"0002 ,2 (2 $2 "00(0S ,00S !00H100S 100S 0S+ 000 -@100S O0S t000 00P0S 000 0 0S \000 00 U000 00 K褊Ԋ؊,8HЊTĊdpȊ܊(̊ (0Th -LM   0 00S 00 K -L M00S00 '00I00 0S00 x00 p00Q0 P00R 00 40000 00 0 K̊ -L M $ ( (00 00  0$ 04R 0 00$ 0$00$0  0$ 04;#; 4000 (00C(0 (0S 1 04 c(0R1 040c(0 (0S& ( 00$00 0S 0 00 0$ 00,0 0S 0$0 0$0,0 0,0 0S 0,0 0S 0,0 0,0 ,0 K̊ -L M   0$0 c0$000 0 0$000 04;#; 400C0 0S K -LM M0 0 00 00 0(0 >K 0C0C0 >K 0C0C '70S KP$00 00$0 $0S:KP$0S $0*KP4088 &0 K0|&0 K0p&0 K0d&0 K00(0 00 1=K 0C 00 0S9L<[-SK<[-S3 1=K 0C s==K 0C0S 5D8 5@8 0<8 Q=K 0CL8 a=K 0CH8 -K BAK AK LL!=K 0C0;0+ 0=K 0CT0S 0D8 -K BqK AK LL0000+ 0-K BK L;0+ 00SA=K 0C0S} a=K 0C0S A>K 0C 0C$0S 0*KP4 A>K 0C 0CX00 00 0(4K( KK L L00 0-0$0 $0S 0S cA>K 0C 0Cm(0S (0L$ KP$0 0 0S  +Q=K 0CN00q0 0 00S 00Q-K BD(0S (0 00(0 0S T0 0 00Sc 0 008( 0 000S" 00  00a=K 0C 00.0 0 0 0S= 0 0a-K Bq=K 0C000 0 00S& 00q-K BA>K 0C 0C000 0 00S 0 A>K 0C 0C 00 :KP? 0S) 00S 00 00S 00 0 0S 0 0 00S 00 00S 00 (0S (0y0S A>K 0C 0C0*KP4KP4 K ̊l -LM x cR00 0s00 u90S X00 00 0 K -LMM@ D H$ L4 080 <40 000 B>K 0C0C 0 D4S H4S 40S000 00S 0(0 4 B>K 0C0C0S B>K 0C0C0 0 00 :0K@ 0$0 $0S 0,0 :[(  000Q(00(0 ( 0Rn (0S=D4S 00D&80080 !00S 80 40R000 40040 400000 00S000 8 00 00080080 0 (00C@ <:0K@ 70(0 D4S :0[D80080 00S 80 40R000 40040 400V000 00S000 H8 00 :0[080080 u:0K@ 0$0 $0S 0,0 ?:0[ S90[ S :0[-S:0K@ 00S 40S 000 8 00 008000000 00S000 H$000L4S L$8000P4 0,0 H4S 00S 0(H$00L4S L$0000S 0H4S H$00,0P4 P4 K -LCM0 4 8$ <4 ;(0 0$0 0 0 00 0S 0!00 00000 0!<400S04004 0 040000:S040"S:04004  0 84R 44 0400 00 0 04004 040S 040"S04004 040S 040;S 0 84R 44 0400 00 0 04004 040S 040;S84S 44 0000 04004 04004 040S 0 040000:S0$0 $0 (0R $04L# K0 00$00$0 04004 040S ]0 0400000S(0S $0" K0 0004004 040S @0 040000:S040=S04004 04004 040S &0 040000:S00 00 0!<40 A>K 0C 0C= 0S 0!0000 000 0!<400S040"SD04004 0S 0 0R 0 0400000 04004 040S 040"S04004 040S$ 040;S0!<400S 0 0R 0 0400000 04004 040S 040;S0S  0 00040;S K -L,M( , 0 40 00 00 00 0K( 00 0S 080 0[ S0K( 00 0SY0[ SV 0K( P0[ SM 0[:S0S 00 Z0 0[000:S0K( 0K( Y0S 0S>0 0[000:S00 C0R ,0 0[0000 0S 0 C0R 40 0[0000 00S  ,0 000S  40 000S 0S 080 080 80 K -L 0 000̊ -L4M8 < 0(0 0 0 00 00 (00 00 ( 8000=S00 (00(0 (00(0 000 ( <0R0S  80 ,0K 0S 0@0 (00 00 ( 8000&S00 (00(0 (00(0 000 ( <0R 80 00K 0S ,0{0@0 0$0 $0S,0n00k0@0 |, $0 0 $0 $00s0 $0 0 $0 $0 0S ,0M00J$H0@0 Y$0 00{0 $0 $00S,04001$0 0-$+0@0 <$0 00^0 $0 $00S,000$0 0$00 $ 0@0 $0 00$ 00 0SP $00 $00$0 0 0S ( <0R0@0 @0 K蠆 -L,M( , 0 0 0 00 00 00 0000$0 $0SK040 V ,0000 080 80S" 80S:80S$ 40%S0 0 .0+S $0 00000 " $0 000000  0120 0 0  0!000  $0 000000 0 0 000  00R $0 00( $00040 40 K褆 -LM00 ,!01000 0S!00 00 00 00 00 00 00 00 00 00 01 01x 0 1l 01` 01T 01H 01< 010 01$ 01 01 01 K褆 -LM200 #000 00 000 000000S 000000 0S\10SK P10D10810,10 1010100000000000000000000000x00 00 00 K蠆Ԋ؊ЊĊȊ܊( -LM  9 00 0S< }0$0  020$0 $0 K -L M $ ( 00  00 0S$ Z0,0 70 00 0 (0R $0 000000 000 00S(0S  $0 000 00S0,0 0 0-0 (00CR0,0 0,0 ,0 K -L M $ ( 00  00 0S(0S $0 0,0 7000 0 (0R $0 000000 000 00S(0S  $0 00000S 0,0 000 (00CR0,0 0,0 ,0 K -LM  p 00 0S0S  000 0 000S0S  00 0 0 0S 0 0 0 0 0 K -LM  ? 00 0S 000 0 -000S 00 0 0 "00 0S 000 0 00Tj 0 00SI 0 0  000 0 0 K -LM  $0 00 0S 0(0  00z00 0S 0(0 $ 000(0 (0 K -LM 0S 00 0000 0 K -LM  00 0S< 0$0  00$0 $0 K -L$M, 0 00 ,0 0 0S 000 0 0 0S0010$0 $0S0 00040 _00 0!$0 00000  0R,h0 0 0SC 00 00000 0!$0@0000!$000S$0 00040 '0!$00 000!$000  08000 =0 0 0S0 $00040 0 $00040 40K -LM  00 0S 000 0 00O0 0 0 0 0 K -LK,Y00 0S ! 10>K9 1 0 K -LEM  ! 1 C?K,!C/K00!1 K -LDM0 4 8 <0 $0K$$ 800(0 (0K/0 0 0 0 0A 0 P 0 x0a 00v. 0p 0 000@P ` p<0 0 0 40K踊,H  -LM 00  鸊x -LM  00 0 K踊 -LM 00  鸊 -LAMM  00 0S0$4 '@0S 4080S |4000S  `40(0S D40 0S (400S 400S 300S 300S 300S 300S 300S d300S H300S ,300S 300S 200S 200S 200S 200S 200S{ h200Ss L200 g000Sg 000S_ 0 0|0SW 00t0SO 000SG 00 K0S-~0S0v40 A>K 0C00 0R 0e#0A.K BK+ 040S 0U0SP0S 000 0Se0$4 ` m0$4 $4 KԊ؊ЊĊȊ܊(̊ -LM  A00 0 0T0 0R 0 0 0 0 0 K -L M  0K 0:0S00 00 0 K -LM8 0(0 0 0 80,0 ,0S0<8 00K,0Sw 0050S 000<8 00,t0Sa ,`0S[ ,L0SU ,80SO ,$0SI ,0SC ,0S= ,0S7 ,0S1 ,~0S+ ,x0S% ,r0S ,l0S ,pf0S ,\`0S  ,HZ0S ,4T0S , N0S , H0S ,B0S ,w0S 0$0 +0(0 (0S,,P0<8 ( +(0,!0S (4,>X$000<8 (00,0S (0 0,0S (00,0S (00,20S 40K,+0S 40S{ (000 >K 0C0C0S 0 0 >K 0C0CT00 0S;0 0 ~00 0 S;0  B>K 0C0C,0+00 0S 0 0 >K 0C0C` B>K 0C0C00 0R 0 0 >K 0C0CI0 0b0 0S>K 0C0C000 (0 (00S0 0 >K 0C0C'(0 >K 0C0C 0 (0 (00S0 0 (0  $0S $ (00T!(00(0$0 0 0 L,p(0S) (00S (00Y(00S (00Q(0 0S (0 0I(00S (00A(00S (009(7 0<8 <8 KԊ؊ЊĊȊ܊(̊ -LM  0K00S0 0 &00?0 0 00S0 0 0 0 0D0 0R 0 0 0 0 000 0 0 K -L M   0%0S00 00 0 K -L M  00S 00S00 300 000S00 )0 00000;S 00@000T 00 0 00R 00 000 000 0K -L M  00S00 000S00 )p0 00000;S 00@000T 00 0 00R 00 000 000 0K -LM $ 000 0 0阆 -L Mp000 0 \0 0 P00n0S00  00S00 0 K蜆 -L M $B00  000 K -L M 00 000 000 000 0S K -L M, 00 200 00=S000 000 00S0010$0 $0S, 00000 0 0  0!$0 00 00 0 0R0 0 100 o000 00S 0 00000:S00 000 00S 00=S 0R8 0!$0@ 00c000 0!$000S$m, 00000 9 0!$00 00c ^ 0!$00 00c 00 00 0 000 00S 00;S00S 00;S000 00S, $00000 00K谊 -L M, 00 X20$0 H20 0 $0 00]0S 00 0 $0R000 $00$0 $0S001'0(0 (0S, 00000 a00 0!(0 00000  0RP10$0 00 C810 0 $0 000S2 00 0 $0R$00000 0!(0@0000!(000S(, 00000 0!(00 $00000 $00$0 $0S, (00000 00K蠆 -L M  00<S+20&0s 00 20l0s 00 20t0s 00 T20;0s{ 00 00&S620&0s 00 x10a0s 00 m10mt0s 00 b10pi0s 00 Wh10;^0s@ 00 L00>S+,10&O0s 00 =10gD0s 00 200t90s 00 '00;.0s 00 00 p00 0s 00 000 0S00 00C0 RI00 0 K踊 -LM 000 -L M  K00"S6X10&0s 00 H,10#0s 00 =1030s 00 20040s 00 '00;0s 00 00 p000s 00 000 0S00 00C0 R00 0 K踊 -LM Q00 -LM  0S@$00 P p00l IT00T B0S 0000 <00}@ K -LM  t00 0S0$0   070S 0$0 0$0 $0 K -LM  t00 0S0$0   00S 0$0 0$0 $0 K  -LM  m00 0S0$0  0S0$0  00   0R 0$0 0$0 $0 K$ -LM  900 0S0$0  0S0$0  >00   0R ~0$0 y0$0 $0 K$ -LM 0S $000 000 0 Kx -LM04 8" 02K00  &00 0S(02K 02K0$0 02[(2K82S 42S ?K048"00 82(0K K0  @000 " K!8 -L,M03K0(0  00 0S040 /(K00 000 0S 040 $0K 02K3[02KT0 0 $0K 0s040 040 40 K8 -LM >K0 00  01000 0S12 1 K0001 020 1 K000 0 00 >K,`.K 0K0  000 0S >K,08 Kl -L(M $ ( ,0 (0K0 00 $ s00 0S000 0 -, K00020s000 ?000 00 K -LM   0 0000 00 KDL -LM   0 0000 00 KLD  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3#/G-T``pg@ @00bCQ@`  @T:d@-@3/0@DsT--/var/configtext/plain{"success":"true","name":"%s","desc":"%s","sys_enabled":"%s","auto_broadcast":"%s","amp":"%d","dev":"%d","bdelay":"%d","video_dev":"%d","pro_type":"%s","off_delay":"%d","scr_time":"%d","audio_amp":"%d","audio_vol":"%d","audio_treble":"%d","audio_bass":"%d","mic_amp":"%d","mic_vol":"%d","mic_treble":"%d","mic_bass":"%d","brd_vol":"%d","check_bit":"%d","data_bit":"%d","stop_bit":"%d","baund_rate":"%d","open_len":"%d","open_cmd":","close_len":"%u","close_cmd":","video_len":"%u","video_cmd":","vga_len":"%u","vga_cmd":"%02XSERVER_SOFTWARESERVER_NAMEGATEWAY_INTERFACESERVER_PROTOCOLSERVER_PORTREQUEST_METHODPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_HOSTREMOTE_ADDRAUTH_TYPEREMOTE_USERREMOTE_IDENTCONTENT_TYPEboundary=CONTENT_LENGTHHTTP_ACCEPTHTTP_USER_AGENTHTTP_REFERERHTTP_COOKIEpostapplication/x-www-form-urlencodedmultipart/form-datagetContent-DispositionnamefilenameContent-Typeform-dataw+b/tmp/cgicXXXXXX --%srb%dSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecSet-Cookie: %s=%s; domain=%s; expires=%s, %02d-%s-%04d %02d:%02d:%02d GMT; path=%s Location: %s Status: %d %s Content-type: %s wbCGIC2.0 disableenabletext/plain{"success":"false"{"success":"true","msg":"%s"rw+b/dev/i2c-eeprom0127.0.0.1utf-8gb2312q{ lH ' Dooo l GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HH' /'7o Do @S  \   e ` lk `pqll~ wxx~TTXX``hhllDDh|plpc3250/usr/www/logo.jpg0000777000000000000000000002362713635024723013771 0ustar rootrootJFIF,,C     C   \" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?-|\Ο[v3QC:h'p@l\gCψm?Q|eIzhRt-Ez?ԃ/5(uGjB/wO>_5O"]qIROEGqi?R>Ɵ򯸥Z?◌m?c7R/gFs3UɥJjʾOmSuc⇌#f>'׭o*UR%G+TgX?a7RKW(;TS*?T>&x?5k_0ĿqN Zv*ʾZ_^.YUL|Zh>_*US/eOWZSu?8X|Ff?g?>_*ڥ+7J򯸥V?oFmcA\KtUs#J;TPUg2|CIW|BN?dտ:_*ץO򯸵V?1#TV?SX-N]a-W5( ^*UI=RsQ|AcBWƤMS?5*Dcإ)w5FcB_ƥ]wR.f/J:TũK7ԉsk5*Tq]sEuC?s[jd/N2Tr>j_n?HTN6]}U~OԃT} P^(P*}5;jWy)RZ#Dtj7YRBTZvE&˩s?fK-TJ*ZE˂}]Ϗf(SdZl.?R%ZjReq.ֿjULeS/JZ'YoΞ%|}R)GevStK)!'HJ*h}QHgW_,>9z䗭u÷=^C~GdJ;TCJ;VJTPZ&AңAҡWJRWL*S/J͚"TRD*T-%N*ӥK)HTPZ%N*Jj DRZ*TR%^"Tk֤J̲QڦJva֤1֤6Z$^:T ֧J(RR H:ԣD:ԣC-N*ץIh:SJbt L0PL;T2*TңJzT2*tRN*T2SD*TPDR%F"T3BaڦJvJ:ԉ֣jDR%^2WL*h*UQ%JjhujujZ&J*$RGjtjte"URD*T0RJtW&Z%N"TiҤJ̤N*TQ/J:TJ*TeZ*S%AdRZ*TPY"GZzԣC(*UQ%JjM(RR՛)%HTRDõJ:TCJ:TWJReUS/JzҥH:TiҤ*h*dPL*H*TJZERK;{޹%]o_,>9z䗭~CP__(RRգ3DRD*Tj0 ('h'PէZ}i MqnA` g'esH&~ _cM@56;9|9Ri'_{º7>2aVzŐ[@Ǹ4xm޾$;*Nwg S2J.x5K㯈v"P)Zk?2FtEvg>lvϯw,w.c-W`2@,r>|EК}X:Kfsv2lz(>X;XxGʩǫ1^%:8xRv{+ac_Vl֎W>8ǂO^,Լ;B!,e)ʰ꬧ cX_c~_ĿƝ]( ͏O7+d <+h0.fi]A?*(8_S ⒡Jur+OMU׫NJ0{m_ZTҽ[_ k?|OH8ԙ7Z(.G8W~߲~sK~"mkynI+vThSNy=JyuzVgT]?φOxVQFIХE_:-׵$7Bv@݅R x8N>jWvl&lvW|djU^B|kkxPѯѤunGWt9z䗭u÷=^C~GdJ;TCJ;VJTPZ&c¿2?+v_L,#.cff8&a#D=|/7.?8O|keco\hCo I#,UCdp1='eu;=&s./XcZ< @j.R9f&2MyUi32M/?3ࣟ(?b'g.xķvڌZڳ oo.eϪJߎ`Ox6d/uwTb0N o'ÿ~k k1GX鉋Hxp\b*_Jziu(ccVZ+뵏#~'7;x2M4מ;R~_120_~Y.`iA{Q}o;ҵ־%OKg̐|ȝA9–\mBtÏ|k:<_mmLZȡmT !b%Y&ot "(zn(5/|! GǶ:^,sΌ Mr1=z_V?UPRy;]SPg^vRV,W5nj>/Śe<)sm}X,Aۆq?ǥ|V4KFM[AxJݩ +]ǿ>3Uӳo-Bۓ x2%N_gF/)aTETg#y+]"c,;%iev}z׶~w Kb;-o&U8*Lw;y=xMz5B> kM[H*TQ%Jkd֤JzԉYJ;TP2TL:ԃF:ԃfD֧JzRZ%QҢQҡZvZveTץ@:-JxLNҡjZ%JzTiR/JR%N*TIҥJZ&^*tJ*h*DҤJhL;TP2T2GZ:cHjYd֦^ C-Jj$WC-߆%s--sKCa$wI9v0)}~حm.YFpgUwmHn.<,3`Wjneh3i6nky'p~yUyS_W=Z\)xFүI4y˞3YiSwp_LcE$/ ])[ѭo5;Xd. hpXs\v[iZjW:M  8 b6\լ2\\E*ZW`Ԓxth"c"mB08gm #soi:=,1_v[ZRoQe4[{K&SĥeFVkؘtúE^^ XH,;\]M埅oWKIhڎAI'-|iїÚK!I7>_Sfh. F&̘O?Za:n-\\[6@Udw ~5/5{˫y!Q)&:.ztrgUM!үik$н9壄,OӜUW􈧟RKe9v9]fsGsA>!;Lя. hs76 1Ү APNZJsrn{B@83ҙv@R ڂ%A#5+ݝѵxі9X0RY?&ַdJ*C1\V2F`M`pL|EY]+ݘL :ʪ)R:ֹV)4l$ # Ec;hfޞoH8zQS>6nd7 Mf{Vl.7ˌ`+V j;Xc礗Gf\GrrĘjVHJ*Ddaڥ*!ڥ*KDҥJzTY*BjeRDҤ*4R L2tRN J*TIRC-) J%?\/vGrKֿ~(z/~Y̔uGjuGjљTRJ* DõH:TcH:T2*R^*T*BjeYDJ*TJDӥ@:te"TJ* D֥^uWAh*TQ%JjYd֤JzԉYJ;TP2TL:ԃF:ԃfD֧JzRZ%QҢQҡZvZveTץ@:-JxLNҡjZ%JzTiR/JR%N*TIҥJZ&^*tJ*h*DҤJhL;TP2T2GZ:cHjYd֦^ C-Jj$WC-i6մVYՓ.kvXnsH;VRdL'5*TIR hI]J!ܾb\+B)(T!$bǯ,a(YJ1{HKftxSeiRRKpAzV,5+ X>tҥJ0~h)|Lt+^N[nWOҥ^4ԤZWZmRXyoSV/ՅԊwn r*D#}mץOo3vFSP/J:Rl#[.cUn2N-yiu=º$<>*VN1k-YK˙'#nf& utױXmKPcȲ jTֳ4/˨PD2[tɨGZzԣE62+NC*Hm慰W{#?T^6FQ[dHT}}j!ڢjQڢ*dR%F"T0RR%URD*Thzҡ^2eDRtJZ&J:T)S'JR%J*$RE~%|eIzW?b/xZαu]ʑ\@]ܱ $$$`>_שg8ӌ[z%~EII%}OGZv?Ⴜ?/? ҏ7#b"?[p]Jq|&*W#&3O_OCb!?O,oe _r[cb!?9a[?yv_yRׁżAp| ?+Լac;/zҾuԃ"0'wB^"Wk;??j?dk5Sc/v'ĵ#b:Tka{We' _X/_/5OoGuyYN)t_yҾu!1 gEjỿ{/\vGJeO CX25yqK*_yR2υ5o¼/7RL?wץ}6?e _n?f/ տ_nO,}Ҟ:W 2x_o2`cu/3qk,v_yZTõ} ?f ~n?f ~nKb;/*E_F?Tp|4?T5;/:T_Cc_uO/ԼƇw|*T_@Ã_u?NGj?"Bwx T^j_?">xxc*^>_du<>?R{EC/>ჭHkܿD#^E8| AC'KG G/ZzWC'N41/ZO"㨖5Jz׳zE8|_)Lk PRJ!M_&u}Se5CҥJ8kpms}/RXy"uu=iZK>{ RTֻ!-n? pU?g*} 8RYk??}C*}J39TWu ;A-&SDž-SbZ#jQں?EGOc*HHҤJ/?¤/?§DNFRn?O;r~c){Hْ*TA?O8iC)A֦^ti=t.HVSN VŌc~tcAݪ[E$RNA*;I*SBOQRERlpc3250/usr/www/js/0000777000000000000000000000000013635025736012733 5ustar rootrootlpc3250/usr/www/js/slider.js0000777000000000000000000001655713635024723014567 0ustar rootroot// Title: tigra slider control // Description: See the demo at url // URL: http://www.softcomplex.com/products/tigra_slider_control/ // Version: 1.0.2 (commented source) // Date: 08/21/2008 // Tech. Support: http://www.softcomplex.com/forum/ // Notes: This script is free. Visit official site for further details. function slider (a_init, a_tpl) { this.f_setValue = f_sliderSetValue; this.f_getPos = f_sliderGetPos; // register in the global collection if (!window.A_SLIDERS) window.A_SLIDERS = []; this.n_id = window.A_SLIDERS.length; window.A_SLIDERS[this.n_id] = this; // save config parameters in the slider object var s_key; if (a_tpl) for (s_key in a_tpl) this[s_key] = a_tpl[s_key]; for (s_key in a_init) this[s_key] = a_init[s_key]; this.n_pix2value = this.n_pathLength / (this.n_maxValue - this.n_minValue); if (this.n_value == null) this.n_value = this.n_minValue; // generate the control's HTML document.write( '
' + '
' ); this.e_base = get_element('sl' + this.n_id + 'base'); this.e_slider = get_element('sl' + this.n_id + 'slider'); // safely hook document/window events if (!window.f_savedMouseMove && document.onmousemove != f_sliderMouseMove) { window.f_savedMouseMove = document.onmousemove; document.onmousemove = f_sliderMouseMove; } if (!window.f_savedMouseUp && document.onmouseup != f_sliderMouseUp) { window.f_savedMouseUp = document.onmouseup; document.onmouseup = f_sliderMouseUp; } // preset to the value in the input box if available var e_input = this.s_form == null ? get_element(this.s_name) : document.forms[this.s_form] ? document.forms[this.s_form].elements[this.s_name] : null; this.f_setValue(e_input && e_input.value != '' ? e_input.value : null, 1); this.e_slider.style.visibility = 'visible'; } function f_sliderSetValue (n_value, b_noInputCheck) { if (n_value == null) n_value = this.n_value == null ? this.n_minValue : this.n_value; if (isNaN(n_value)) return false; // round to closest multiple if step is specified if (this.n_step) n_value = Math.round((n_value - this.n_minValue) / this.n_step) * this.n_step + this.n_minValue; // smooth out the result if (n_value % 1) n_value = Math.round(n_value * 1e5) / 1e5; if (n_value < this.n_minValue) n_value = this.n_minValue; if (n_value > this.n_maxValue) n_value = this.n_maxValue; this.n_value = n_value; // move the slider if (this.b_vertical) this.e_slider.style.top = (this.n_pathTop + this.n_pathLength - Math.round((n_value - this.n_minValue) * this.n_pix2value)) + 'px'; else this.e_slider.style.left = (this.n_pathLeft + Math.round((n_value - this.n_minValue) * this.n_pix2value)) + 'px'; // save new value var e_input; if (this.s_form == null) { e_input = get_element(this.s_name); if (!e_input) return b_noInputCheck ? null : f_sliderError(this.n_id, "Can not find the input with ID='" + this.s_name + "'."); } else { var e_form = document.forms[this.s_form]; if (!e_form) return b_noInputCheck ? null : f_sliderError(this.n_id, "Can not find the form with NAME='" + this.s_form + "'."); e_input = e_form.elements[this.s_name]; if (!e_input) return b_noInputCheck ? null : f_sliderError(this.n_id, "Can not find the input with NAME='" + this.s_name + "'."); } e_input.value = n_value; } // get absolute position of the element in the document function f_sliderGetPos (b_vertical, b_base) { var n_pos = 0, s_coord = (b_vertical ? 'Top' : 'Left'); var o_elem = o_elem2 = b_base ? this.e_base : this.e_slider; while (o_elem) { n_pos += o_elem["offset" + s_coord]; o_elem = o_elem.offsetParent; } o_elem = o_elem2; var n_offset; while (o_elem.tagName != "BODY") { n_offset = o_elem["scroll" + s_coord]; if (n_offset) n_pos -= o_elem["scroll" + s_coord]; o_elem = o_elem.parentNode; } return n_pos; } function f_sliderMouseDown (n_id) { window.n_activeSliderId = n_id; return false; } function f_sliderMouseUp (e_event, b_watching) { if (window.n_activeSliderId != null) { var o_slider = window.A_SLIDERS[window.n_activeSliderId]; o_slider.f_setValue(o_slider.n_minValue + (o_slider.b_vertical ? (o_slider.n_pathLength - parseInt(o_slider.e_slider.style.top) + o_slider.n_pathTop) : (parseInt(o_slider.e_slider.style.left) - o_slider.n_pathLeft)) / o_slider.n_pix2value); if (b_watching) return; window.n_activeSliderId = null; } if (window.f_savedMouseUp) return window.f_savedMouseUp(e_event); } function f_sliderMouseMove (e_event) { if (!e_event && window.event) e_event = window.event; // save mouse coordinates if (e_event) { window.n_mouseX = e_event.clientX + f_scrollLeft(); window.n_mouseY = e_event.clientY + f_scrollTop(); } // check if in drag mode if (window.n_activeSliderId != null) { var o_slider = window.A_SLIDERS[window.n_activeSliderId]; var n_pxOffset; if (o_slider.b_vertical) { var n_sliderTop = window.n_mouseY - o_slider.n_sliderHeight / 2 - o_slider.f_getPos(1, 1) - 3; // limit the slider movement if (n_sliderTop < o_slider.n_pathTop) n_sliderTop = o_slider.n_pathTop; var n_pxMax = o_slider.n_pathTop + o_slider.n_pathLength; if (n_sliderTop > n_pxMax) n_sliderTop = n_pxMax; o_slider.e_slider.style.top = n_sliderTop + 'px'; n_pxOffset = o_slider.n_pathLength - n_sliderTop + o_slider.n_pathTop; } else { var n_sliderLeft = window.n_mouseX - o_slider.n_sliderWidth / 2 - o_slider.f_getPos(0, 1) - 3; // limit the slider movement if (n_sliderLeft < o_slider.n_pathLeft) n_sliderLeft = o_slider.n_pathLeft; var n_pxMax = o_slider.n_pathLeft + o_slider.n_pathLength; if (n_sliderLeft > n_pxMax) n_sliderLeft = n_pxMax; o_slider.e_slider.style.left = n_sliderLeft + 'px'; n_pxOffset = n_sliderLeft - o_slider.n_pathLeft; } if (o_slider.b_watch) f_sliderMouseUp(e_event, 1); return false; } if (window.f_savedMouseMove) return window.f_savedMouseMove(e_event); } // get the scroller positions of the page function f_scrollLeft() { return f_filterResults ( window.pageXOffset ? window.pageXOffset : 0, document.documentElement ? document.documentElement.scrollLeft : 0, document.body ? document.body.scrollLeft : 0 ); } function f_scrollTop() { return f_filterResults ( window.pageYOffset ? window.pageYOffset : 0, document.documentElement ? document.documentElement.scrollTop : 0, document.body ? document.body.scrollTop : 0 ); } function f_filterResults(n_win, n_docel, n_body) { var n_result = n_win ? n_win : 0; if (n_docel && (!n_result || (n_result > n_docel))) n_result = n_docel; return n_body && (!n_result || (n_result > n_body)) ? n_body : n_result; } function f_sliderError (n_id, s_message) { alert("Slider #" + n_id + " Error:\n" + s_message); window.n_activeSliderId = null; } get_element = document.all ? function (s_id) { return document.all[s_id] } : function (s_id) { return document.getElementById(s_id) }; lpc3250/usr/www/js/idste.js0000777000000000000000000002021713635024723014401 0ustar rootrootvar proj_types = [ { "type_name": "" }, { "type_name": "3M", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "5", "open_cmd": "7E504E0D", "close_cmd": "7E50460D", "video_cmd": "7E53560D", "vga_cmd": "7E53520D" }, { "type_name": "ACTO", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "6", "open_cmd": "4130300D", "close_cmd": "4130310D", "video_cmd": "4133330D", "vga_cmd": "4130350D" }, { "type_name": "CANON", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "6", "open_cmd": "0200000000020D", "close_cmd": "0201000000030D", "video_cmd": "020300000201060E0D", "vga_cmd": "02030000020101090D" }, { "type_name": "SHARP", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "5", "open_cmd": "504F5752202020300D", "close_cmd": "49564544202020310D", "video_cmd": "49564544202020310D", "vga_cmd": "49524742202020310D" }, { "type_name": "SONY", "scr_time": "120", "off_delay": "120", "check_bit": "2", "data_bit": "0", "stop_bit": "0", "baund_rate": "7", "open_cmd": "A9172E0000003F9A0D", "close_cmd": "A9172F0000003F9A0D", "video_cmd": "A9172A0000003F9A0D", "vga_cmd": "A9172B0000003F9A0D" }, { "type_name": "EPSON", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "5", "open_cmd": "505752204F4E0D", "close_cmd": "505752204F46460D", "video_cmd": "534F555243452034310D", "vga_cmd": "534F555243452031310D" }, { "type_name": "HITACHI", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "6", "open_cmd": "BEEF030600BAD20100006001000D", "close_cmd": "BEEF0306002AD30100006000000D", "video_cmd": "BEEF0306006ED30100002001000D", "vga_cmd": "BEEF030600FED20100002000000D" }, { "type_name": "SANYO", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "6", "open_cmd": "4330300D", "close_cmd": "4330310D", "video_cmd": "4330370D", "vga_cmd": "4330350D" }, { "type_name": "Panasonic", "scr_time": "120", "off_delay": "120", "check_bit": "0", "data_bit": "0", "stop_bit": "0", "baund_rate": "5", "open_cmd": "02504F4E030D", "close_cmd": "02504F46030D", "video_cmd": "024949533A564944030D", "vga_cmd": "024949533A524731030D" } ]; function $(id) { return document.getElementById(id); } function get_by_name(name) { return document.getElementsByName(name); } function is_ie() { return /msie/.test(navigator.userAgent.toLowerCase()); } function is_gecko() { return /gecko/.test(navigator.userAgent.toLowerCase()); } function is_ff() { return is_gecko(); } function set_form_value(field, value) { field.value = value; } function set_el_disabled(el) { el.disabled = 'disabled'; } function set_el_enabled(el) { el.disabled = ''; } function set_form_radio(fields, value) { var length = fields.length; var index; for (index = 0; index < length; ++index) if (fields[index].value == value) { fields[index].checked = "checked"; break; } } function set_form_checkbox(fields, values) { var length = fields.length; var index; for (index = 0; index < length; ++index) if (fields[index].value == value) fields[index].checked = "checked"; else fields[index].checked = ""; } function set_form_select_single(field, value) { var ops = field.options; var index; for (index = 0; index < field.length; ++index) if (ops[index].value == value) { ops[index].selected = true; break; } } function is_ip(ip) { var reg = /^(([1-9][0-9]?|1[0-9]{2}|2[0-5][0-9])\.)(([0-9]{1,2}|1[0-9]{2}|2[0-5][0-9])\.){2}([0-9]{1,2}|1[0-9]{2}|2[0-5][0-9])$/; if (null == ip || ip.length < 7 || ip.length > 15) return false; if (reg.test(ip)) { var ary = ip.split('.'); var dig1, dig2, dig3, dig4; dig1 = parseInt(ary[0]); dig2 = parseInt(ary[1]); dig3 = parseInt(ary[2]); dig4 = parseInt(ary[3]); if (dig1 <= 0 || dig1 > 224) return false; if (dig2 < 0 || dig2 > 255) return false; if (dig3 < 0 || dig3 > 255) return false; if (dig4 <= 0 || dig4 > 255) return false; return true; } return false; } function is_net_mask(mask) { var reg = /^\d{1,3}(\.\d{1,3}){3}$/ if (reg.test(mask)) { var ary = mask.split('.'); var key; for(key in ary) if(parseInt(ary[key]) > 255) return false; return true; } return false; } function is_hex(str) { return /[0-9a-fA-F]+$/.test(str); } function create_xml_http_request(callback) { var xml_http; if (window.XMLHttpRequest) xml_http = new XMLHttpRequest(); else xml_http = new ActiveXObject("Microsoft.XMLHTTP"); xml_http.onreadystatechange = function() { if (4 == xml_http.readyState && 200 == xml_http.status) { var result = eval("(" + xml_http.responseText + ')'); if (callback) callback(result); } } return xml_http; } function ajax_request_get(url, callback) { var xml_http = create_xml_http_request(callback); xml_http.open("GET",url + '?t=' + new Date().getTime(),true); xml_http.send(); } function ajax_request_post(url, params, callback) { var xml_http = create_xml_http_request(callback); xml_http.open("POST", url, true); xml_http.setRequestHeader("Content-type", "application/x-www-form-urlencoded"); xml_http.send(params); } function form_submit(form, check_func, wait_func, callback) { var len = form.length; var index, send_str; var url = form.action; if (null != check_func && !check_func()) return; send_str = ""; for (index = 0; index < len; ++index) { if ('button' == form.elements[index].type || 'submit' == form.elements[index].type || 'reset' == form.elements[index].type || ('radio' == form.elements[index].type && !form.elements[index].checked) || ('checkbox' == form.elements[index].type && !form.elements[index].checked)) continue; send_str += form.elements[index].name + "=" + form.elements[index].value + "&"; } if (null != wait_func) wait_func(); if ("post" == form.method) ajax_request_post(form.action, send_str, callback); else ajax_request_get(form.action + "?" + send_str, callback); } function menu_selected(comp_id, menu_id) { var menu_items, index, t; menu_items = $(comp_id).childNodes; for (index = 0; index < menu_items.length; ++index) { if (!is_ie()) { t = 2 * menu_id + 1; if (t == index) menu_items[index].className = "menu_item_selected"; else menu_items[index].className = "menu_item"; } else { if (menu_id == index) menu_items[index].className = "menu_item_selected"; else menu_items[index].className = "menu_item"; } } } function set_form_values(form, values) { var len = form.length; var index; for (index = 0; index < len; ++index) { if ("button" == form.elements[index].type || "submit" == form.elements[index].type || "reset" == form.elements[index].type) continue; if ("select" == form.elements[index].type || "select-one" == form.elements[index].type) set_form_select_single(form.elements[index], values[form.elements[index].name]); if (("radio" == form.elements[index].type) || ("checkbox" == form.elements[index].type)) { if (form.elements[index].value == values[form.elements[index].name]) form.elements[index].checked = "checked"; continue; } form.elements[index].value = values[form.elements[index].name]; } } function ltrim(str) { var i; for (i = 0; i < str.length; i++) if (str.charAt(i) != " " && str.charAt(i) != " ") break; str = str.substring(i, str.length); return str; } function rtrim(str) { var i; for (i = str.length - 1; i >= 0; i--) if (str.charAt(i) != " " && str.charAt(i) != " ") break; str = str.substring(0, i + 1); return str; } function trim(str) { return ltrim(rtrim(str)); } function ip2int(ip_str) { if (null == ip_str || '' == trim(ip_str)) return 0; var ary = ip_str.split('.'); var ip, index, t, i; ip = 0; for (index = 0; index < ary.length; ++index) { t = parseInt(ary[index]); i = t << (index * 8); i = (i >>> 0) + ip; ip = i; } return ip >>> 0; } function cfg_callback(result) { if ("true" == result.success) window.location.reload(); } lpc3250/usr/www/recordcfg.html0000777000175100017510000001056312160244701014166 0ustar 10011001 Reach WEB 配置
录播参数
禁用录播:
服务器IP地址:
文件名:
(最多31个字符)
Mask:
(0~255)
录播设备:
支持索引:
支持  不支持
lpc3250/usr/www/pass.html0000777000000000000000000000576513635024723014166 0ustar rootroot iDste WEB 配置
修改密码
旧密码:
新密码:
确认新密码:
lpc3250/usr/www/reboot.html0000777000000000000000000000271513635024723014502 0ustar rootroot iDste WEB 配置
lpc3250/usr/etc/0000777000175100017510000000000012326426100011260 5ustar 10011001lpc3250/usr/etc/gpioDrv.ko0000777000175100017510000001143513635025736013252 0ustar 10011001ELFa( 4(GNUtz(EuGхݪvz p-L M!40gS`0  0 a1Q 1Q&=?00  003S$PK P ,C$Q>1 1R 0 103M?@0  003S$PK P $0@St 100000 3R 0  P ,Kpg@ ; -L -LM|@  00QXX0S0 0 P0(@P@X lpc3250_gpio_ioctl@@@@$@T$T%s %d 0x%x <4>LPC3250_gpio_ioctl: copy_from_user failed <4>LPC3250_gpio_ioctl: gpioInfo.gpioIdx >= eGPIO_OUT_TYPE_MAX, idx:%d <4>sbc2440_gpio_ioctl: copy_from_user failed <4>sbc2440_gpio_ioctl: gpioIdx is not valid <4>sbc2440_gpio_ioctl: copy_to_user failed gpio can't register major number gpiolicense=GPLdepends=vermagic=2.6.27.8-svn686-dirty6 preempt mod_unload modversions ARMv5 Kq3Hstruct_moduledO__copy_from_userTg__copy_to_usernEmisc_register^__memzerocsprintkmisc_deregister+gpioDrvGCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2Aaeabi.symtab.strtab.shstrtab.note.gnu.build-id.rel.text.rel.exit.text.rel.init.text.rodata.rodata.str1.1.modinfo__versions.rel.data.rel.gnu.linkonce.this_module.bss.comment.note.GNU-stack.ARM.attributes4$2X . <d8 ,KG <8V(^20m[vH t  @ B" p" 2 ( iL,0-,@0X-x,/,( t.,  )@+*      1 DS@cuT8   l     F @*1;IXgpio.clpc3250_gpio_exit$a$dlpc_gpio_miscdevlpc3250_gpio_ioctl__func__.14258gpio_ctrl_tablelpc3250_gpio_initgpio_cfg_tablegpio_init_val__mod_license316lpc3250_gpio_fopsgpioDrv.mod.c__module_depends____versions__mod_vermagic5misc_deregister__this_modulecleanup_moduleinit_moduleprintk__memzeromisc_register__copy_to_user__copy_from_userlpc3250/usr/etc/appstart0000777000175100017510000000170512330130313013040 0ustar 10011001#!/bin/sh # # Start the second phase application.... # #ifconfig eth0 192.168.1.200 #route add default gw 192.168.1.1 #modprobe usbserial #modprobe ftdi_sio #modprobe pl2303 #ifconfig eth0 up export PATH=$PATH:/opt/lpc3250/usr/bin chmod 777 /usr/share/udhcpc/default.script chmod 700 /opt/lpc3250 mkdir -p /lib/modules/$(uname -r) /opt/lpc3250/usr/etc/gpio start UTC=yes hwclock -s /opt/lpc3250/usr/etc/playerDrv start /opt/lpc3250/usr/etc/vs10xxDrv start insmod /opt/lpc3250/usr/etc/pl2303.ko ln -s /opt/lpc3250/usr/etc/boa /etc/boa /opt/lpc3250/usr/bin/netconfig | xargs /opt/lpc3250/usr/etc/netconf head -c 1 /dev/i2c-eeprom0 | xargs /opt/lpc3250/usr/etc/webconf echo 5000 > /proc/sys/vm/min_free_kbytes echo 32 > /proc/sys/net/core/netdev_budget echo 100 > /proc/sys/net/core/netdev_max_backlog usleep 300000 telnetd usleep 300000 /opt/lpc3250/usr/bin/boa usleep 300000 /opt/lpc3250/usr/bin/Cabinetlayer & lpc3250/usr/etc/boa/0000777000175100017510000000000012301013374012017 5ustar 10011001lpc3250/usr/etc/boa/boa0000777000000000000000000000000013766274656017521 2/opt/lpc3250/usr/etc/boaustar rootrootlpc3250/usr/etc/boa/boa.conf0000777000175100017510000002273713635025736013465 0ustar 10011001# Boa v0.94 configuration file # File format has not changed from 0.93 # File format has changed little from 0.92 # version changes are noted in the comments # # The Boa configuration file is parsed with a custom parser. If it # reports an error, the line number will be provided; it should be easy # to spot. The syntax of each of these rules is very simple, and they # can occur in any order. Where possible these directives mimic those # of NCSA httpd 1.3; I saw no reason to introduce gratuitous # differences. # $Id: boa.conf,v 1.3.2.6 2003/02/02 05:02:22 jnelson Exp $ # The "ServerRoot" is not in this configuration file. It can be # compiled into the server (see defines.h) or specified on the command # line with the -c option, for example: # # boa -c /usr/local/boa # Port: The port Boa runs on. The default port for http servers is 80. # If it is less than 1024, the server must be started as root. Port 80 # Listen: the Internet address to bind(2) to. If you leave it out, # it takes the behavior before 0.93.17.2, which is to bind to all # addresses (INADDR_ANY). You only get one "Listen" directive, # if you want service on multiple IP addresses, you have three choices: # 1. Run boa without a "Listen" directive # a. All addresses are treated the same; makes sense if the addresses # are localhost, ppp, and eth0. # b. Use the VirtualHost directive below to point requests to different # files. Should be good for a very large number of addresses (web # hosting clients). # 2. Run one copy of boa per IP address, each has its own configuration # with a "Listen" directive. No big deal up to a few tens of addresses. # Nice separation between clients. # The name you provide gets run through inet_aton(3), so you have to use dotted # quad notation. This configuration is too important to trust some DNS. #Listen 192.68.0.5 # User: The name or UID the server should run as. # Group: The group name or GID the server should run as. User root Group root # ServerAdmin: The email address where server problems should be sent. # Note: this is not currently used, except as an environment variable # for CGIs. #ServerAdmin root@localhost # PidFile: where to put the pid of the process. # Comment out to write no pid file. # Note: Because Boa drops privileges at startup, and the # pid file is written by the UID/GID before doing so, Boa # does not attempt removal of the pid file. # PidFile /var/run/boa.pid # ErrorLog: The location of the error log file. If this does not start # with /, it is considered relative to the server root. # Set to /dev/null if you don't want errors logged. # If unset, defaults to /dev/stderr # Please NOTE: Sending the logs to a pipe ('|'), as shown below, # is somewhat experimental and might fail under heavy load. # "Usual libc implementations of printf will stall the whole # process if the receiving end of a pipe stops reading." #ErrorLog "|/usr/sbin/cronolog --symlink=/var/log/boa/error_log /var/log/boa/error-%Y%m%d.log" #ErrorLog /var/log/boa/error_log ErrorLog /dev/null # AccessLog: The location of the access log file. If this does not # start with /, it is considered relative to the server root. # Comment out or set to /dev/null (less effective) to disable. # Useful to set to /dev/stdout for use with daemontools. # Access logging. # Please NOTE: Sending the logs to a pipe ('|'), as shown below, # is somewhat experimental and might fail under heavy load. # "Usual libc implementations of printf will stall the whole # process if the receiving end of a pipe stops reading." #AccessLog "|/usr/sbin/cronolog --symlink=/var/log/boa/access_log /var/log/boa/access-%Y%m%d.log" #AccessLog /var/log/boa/access_log AccessLog /dev/null # CGILog /var/log/boa/cgi_log # CGILog: The location of the CGI stderr log file. If this does not # start with /, it is considered relative to the server root. # The log file would contain any contents send to /dev/stderr # by the CGI. If this is commented out, it defaults to whatever # ErrorLog points. Set to /dev/null to disable CGI stderr logging. # Please NOTE: Sending the logs to a pipe ('|'), as shown below, # is somewhat experimental and might fail under heavy load. # "Usual libc implementations of printf will stall the whole # process if the receiving end of a pipe stops reading." #CGILog "|/usr/sbin/cronolog --symlink=/var/log/boa/cgi_log /var/log/boa/cgi-%Y%m%d.log" # CGIumask 027 (no mask for user, read-only for group, and nothing for user) # CGIumask 027 # The CGIumask is set immediately before execution of the CGI. # UseLocaltime: Logical switch. Uncomment to use localtime # instead of UTC time #UseLocaltime # VerboseCGILogs: this is just a logical switch. # It simply notes the start and stop times of cgis in the error log # Comment out to disable. #VerboseCGILogs # ServerName: the name of this server that should be sent back to # clients if different than that returned by gethostname + gethostbyname ServerName iDste # VirtualHost: a logical switch. # Comment out to disable. # Given DocumentRoot /var/www, requests on interface 'A' or IP 'IP-A' # become /var/www/IP-A. # Example: http://localhost/ becomes /var/www/127.0.0.1 # # Not used until version 0.93.17.2. This "feature" also breaks commonlog # output rules, it prepends the interface number to each access_log line. # You are expected to fix that problem with a postprocessing script. #VirtualHost # VHostRoot: the root location for all virtually hosted data # Comment out to disable. # Incompatible with 'Virtualhost' and 'DocumentRoot'!! # Given VHostRoot /var/www, requests to host foo.bar.com, # where foo.bar.com is ip a.b.c.d, # become /var/www/a.b.c.d/foo.bar.com # Hostnames are "cleaned", and must conform to the rules # specified in rfc1034, which are be summarized here: # # Hostnames must start with a letter, end with a letter or digit, # and have as interior characters only letters, digits, and hyphen. # Hostnames must not exceed 63 characters in length. #VHostRoot /www # DefaultVHost # Define this in order to have a default hostname when the client does not # specify one, if using VirtualHostName. If not specified, the word # "default" will be used for compatibility with older clients. #DefaultVHost foo.bar.com # DocumentRoot: The root directory of the HTML documents. # Comment out to disable server non user files. DocumentRoot /var/www # UserDir: The name of the directory which is appended onto a user's home # directory if a ~user request is received. #UserDir public_html # DirectoryIndex: Name of the file to use as a pre-written HTML # directory index. Please MAKE AND USE THESE FILES. On the # fly creation of directory indexes can be _slow_. # Comment out to always use DirectoryMaker DirectoryIndex index.html # DirectoryMaker: Name of program used to create a directory listing. # Comment out to disable directory listings. If both this and # DirectoryIndex are commented out, accessing a directory will give # an error (though accessing files in the directory are still ok). #DirectoryMaker /usr/lib/boa/boa_indexer # DirectoryCache: If DirectoryIndex doesn't exist, and DirectoryMaker # has been commented out, the the on-the-fly indexing of Boa can be used # to generate indexes of directories. Be warned that the output is # extremely minimal and can cause delays when slow disks are used. # Note: The DirectoryCache must be writable by the same user/group that # Boa runs as. # DirectoryCache /var/spool/boa/dircache # KeepAliveMax: Number of KeepAlive requests to allow per connection # Comment out, or set to 0 to disable keepalive processing KeepAliveMax 1000 # KeepAliveTimeout: seconds to wait before keepalive connection times out KeepAliveTimeout 10 # MimeTypes: This is the file that is used to generate mime type pairs # and Content-Type fields for boa. # Set to /dev/null if you do not want to load a mime types file. # Do *not* comment out (better use AddType!) MimeTypes /etc/mime.types # DefaultType: MIME type used if the file extension is unknown, or there # is no file extension. DefaultType text/plain # CGIPath: The value of the $PATH environment variable given to CGI progs. CGIPath /:/bin:/usr/bin:/usr/local/bin:/sbin # SinglePostLimit: The maximum allowable number of bytes in # a single POST. Default is normally 1MB. # AddType: adds types without editing mime.types # Example: AddType type extension [extension ...] # Uncomment the next line if you want .cgi files to execute from anywhere AddType application/x-httpd-cgi cgi # Redirect, Alias, and ScriptAlias all have the same semantics -- they # match the beginning of a request and take appropriate action. Use # Redirect for other servers, Alias for the same server, and ScriptAlias # to enable directories for script execution. # Redirect allows you to tell clients about documents which used to exist in # your server's namespace, but do not anymore. This allows you to tell the # clients where to look for the relocated document. # Example: Redirect /bar http://elsewhere/feh/bar # Aliases: Aliases one path to another. # Example: Alias /path1/bar /path2/foo Alias /doc /usr/doc # ScriptAlias: Maps a virtual path to a directory for serving scripts # Example: ScriptAlias /htbin/ /www/htbin/ #ScriptAlias /cgi-bin/ /www/cgi-bin # Auth: HTTP Basic authorization. Format is "Auth ". # Password file should be readable _ONLY_ by root or trusted user(s). This file # is opened before boa gives out privs. # Example: Auth /secret /var/www/secret.passwd #Auth /internal /etc/internal.passwd Auth / /etc/boa/www.passwd lpc3250/usr/etc/boa/www.passwd0000777000175100017510000000002411663356114014101 0ustar 10011001admin:h4zC108HzUZTs lpc3250/usr/etc/boa/default.passwd0000777000175100017510000000002411663356114014701 0ustar 10011001admin:h4zC108HzUZTs lpc3250/usr/etc/boa/boa_default.conf0000777000175100017510000002273712301013374015151 0ustar 10011001# Boa v0.94 configuration file # File format has not changed from 0.93 # File format has changed little from 0.92 # version changes are noted in the comments # # The Boa configuration file is parsed with a custom parser. If it # reports an error, the line number will be provided; it should be easy # to spot. The syntax of each of these rules is very simple, and they # can occur in any order. Where possible these directives mimic those # of NCSA httpd 1.3; I saw no reason to introduce gratuitous # differences. # $Id: boa.conf,v 1.3.2.6 2003/02/02 05:02:22 jnelson Exp $ # The "ServerRoot" is not in this configuration file. It can be # compiled into the server (see defines.h) or specified on the command # line with the -c option, for example: # # boa -c /usr/local/boa # Port: The port Boa runs on. The default port for http servers is 80. # If it is less than 1024, the server must be started as root. Port 80 # Listen: the Internet address to bind(2) to. If you leave it out, # it takes the behavior before 0.93.17.2, which is to bind to all # addresses (INADDR_ANY). You only get one "Listen" directive, # if you want service on multiple IP addresses, you have three choices: # 1. Run boa without a "Listen" directive # a. All addresses are treated the same; makes sense if the addresses # are localhost, ppp, and eth0. # b. Use the VirtualHost directive below to point requests to different # files. Should be good for a very large number of addresses (web # hosting clients). # 2. Run one copy of boa per IP address, each has its own configuration # with a "Listen" directive. No big deal up to a few tens of addresses. # Nice separation between clients. # The name you provide gets run through inet_aton(3), so you have to use dotted # quad notation. This configuration is too important to trust some DNS. #Listen 192.68.0.5 # User: The name or UID the server should run as. # Group: The group name or GID the server should run as. User root Group root # ServerAdmin: The email address where server problems should be sent. # Note: this is not currently used, except as an environment variable # for CGIs. #ServerAdmin root@localhost # PidFile: where to put the pid of the process. # Comment out to write no pid file. # Note: Because Boa drops privileges at startup, and the # pid file is written by the UID/GID before doing so, Boa # does not attempt removal of the pid file. # PidFile /var/run/boa.pid # ErrorLog: The location of the error log file. If this does not start # with /, it is considered relative to the server root. # Set to /dev/null if you don't want errors logged. # If unset, defaults to /dev/stderr # Please NOTE: Sending the logs to a pipe ('|'), as shown below, # is somewhat experimental and might fail under heavy load. # "Usual libc implementations of printf will stall the whole # process if the receiving end of a pipe stops reading." #ErrorLog "|/usr/sbin/cronolog --symlink=/var/log/boa/error_log /var/log/boa/error-%Y%m%d.log" #ErrorLog /var/log/boa/error_log ErrorLog /dev/null # AccessLog: The location of the access log file. If this does not # start with /, it is considered relative to the server root. # Comment out or set to /dev/null (less effective) to disable. # Useful to set to /dev/stdout for use with daemontools. # Access logging. # Please NOTE: Sending the logs to a pipe ('|'), as shown below, # is somewhat experimental and might fail under heavy load. # "Usual libc implementations of printf will stall the whole # process if the receiving end of a pipe stops reading." #AccessLog "|/usr/sbin/cronolog --symlink=/var/log/boa/access_log /var/log/boa/access-%Y%m%d.log" #AccessLog /var/log/boa/access_log AccessLog /dev/null # CGILog /var/log/boa/cgi_log # CGILog: The location of the CGI stderr log file. If this does not # start with /, it is considered relative to the server root. # The log file would contain any contents send to /dev/stderr # by the CGI. If this is commented out, it defaults to whatever # ErrorLog points. Set to /dev/null to disable CGI stderr logging. # Please NOTE: Sending the logs to a pipe ('|'), as shown below, # is somewhat experimental and might fail under heavy load. # "Usual libc implementations of printf will stall the whole # process if the receiving end of a pipe stops reading." #CGILog "|/usr/sbin/cronolog --symlink=/var/log/boa/cgi_log /var/log/boa/cgi-%Y%m%d.log" # CGIumask 027 (no mask for user, read-only for group, and nothing for user) # CGIumask 027 # The CGIumask is set immediately before execution of the CGI. # UseLocaltime: Logical switch. Uncomment to use localtime # instead of UTC time #UseLocaltime # VerboseCGILogs: this is just a logical switch. # It simply notes the start and stop times of cgis in the error log # Comment out to disable. #VerboseCGILogs # ServerName: the name of this server that should be sent back to # clients if different than that returned by gethostname + gethostbyname ServerName iDste # VirtualHost: a logical switch. # Comment out to disable. # Given DocumentRoot /var/www, requests on interface 'A' or IP 'IP-A' # become /var/www/IP-A. # Example: http://localhost/ becomes /var/www/127.0.0.1 # # Not used until version 0.93.17.2. This "feature" also breaks commonlog # output rules, it prepends the interface number to each access_log line. # You are expected to fix that problem with a postprocessing script. #VirtualHost # VHostRoot: the root location for all virtually hosted data # Comment out to disable. # Incompatible with 'Virtualhost' and 'DocumentRoot'!! # Given VHostRoot /var/www, requests to host foo.bar.com, # where foo.bar.com is ip a.b.c.d, # become /var/www/a.b.c.d/foo.bar.com # Hostnames are "cleaned", and must conform to the rules # specified in rfc1034, which are be summarized here: # # Hostnames must start with a letter, end with a letter or digit, # and have as interior characters only letters, digits, and hyphen. # Hostnames must not exceed 63 characters in length. #VHostRoot /www # DefaultVHost # Define this in order to have a default hostname when the client does not # specify one, if using VirtualHostName. If not specified, the word # "default" will be used for compatibility with older clients. #DefaultVHost foo.bar.com # DocumentRoot: The root directory of the HTML documents. # Comment out to disable server non user files. DocumentRoot /var/www # UserDir: The name of the directory which is appended onto a user's home # directory if a ~user request is received. #UserDir public_html # DirectoryIndex: Name of the file to use as a pre-written HTML # directory index. Please MAKE AND USE THESE FILES. On the # fly creation of directory indexes can be _slow_. # Comment out to always use DirectoryMaker DirectoryIndex index.html # DirectoryMaker: Name of program used to create a directory listing. # Comment out to disable directory listings. If both this and # DirectoryIndex are commented out, accessing a directory will give # an error (though accessing files in the directory are still ok). #DirectoryMaker /usr/lib/boa/boa_indexer # DirectoryCache: If DirectoryIndex doesn't exist, and DirectoryMaker # has been commented out, the the on-the-fly indexing of Boa can be used # to generate indexes of directories. Be warned that the output is # extremely minimal and can cause delays when slow disks are used. # Note: The DirectoryCache must be writable by the same user/group that # Boa runs as. # DirectoryCache /var/spool/boa/dircache # KeepAliveMax: Number of KeepAlive requests to allow per connection # Comment out, or set to 0 to disable keepalive processing KeepAliveMax 1000 # KeepAliveTimeout: seconds to wait before keepalive connection times out KeepAliveTimeout 10 # MimeTypes: This is the file that is used to generate mime type pairs # and Content-Type fields for boa. # Set to /dev/null if you do not want to load a mime types file. # Do *not* comment out (better use AddType!) MimeTypes /etc/mime.types # DefaultType: MIME type used if the file extension is unknown, or there # is no file extension. DefaultType text/plain # CGIPath: The value of the $PATH environment variable given to CGI progs. CGIPath /:/bin:/usr/bin:/usr/local/bin:/sbin # SinglePostLimit: The maximum allowable number of bytes in # a single POST. Default is normally 1MB. # AddType: adds types without editing mime.types # Example: AddType type extension [extension ...] # Uncomment the next line if you want .cgi files to execute from anywhere AddType application/x-httpd-cgi cgi # Redirect, Alias, and ScriptAlias all have the same semantics -- they # match the beginning of a request and take appropriate action. Use # Redirect for other servers, Alias for the same server, and ScriptAlias # to enable directories for script execution. # Redirect allows you to tell clients about documents which used to exist in # your server's namespace, but do not anymore. This allows you to tell the # clients where to look for the relocated document. # Example: Redirect /bar http://elsewhere/feh/bar # Aliases: Aliases one path to another. # Example: Alias /path1/bar /path2/foo Alias /doc /usr/doc # ScriptAlias: Maps a virtual path to a directory for serving scripts # Example: ScriptAlias /htbin/ /www/htbin/ #ScriptAlias /cgi-bin/ /www/cgi-bin # Auth: HTTP Basic authorization. Format is "Auth ". # Password file should be readable _ONLY_ by root or trusted user(s). This file # is opened before boa gives out privs. # Example: Auth /secret /var/www/secret.passwd #Auth /internal /etc/internal.passwd Auth / /etc/boa/www.passwd lpc3250/usr/etc/netconf0000777000175100017510000000060513635025736012661 0ustar 10011001#kill udhcp if it exists ps | grep 'udhcpc $' | awk '{print $1}' | xargs kill -9 if [ $1 = "0.0.0.0" ]; then udhcpc -s /opt/lpc3250/usr/etc/default.script& elif [ $1 = "default" ]; then ifconfig eth0 192.168.1.10 netmask 255.255.255.0 route add default gw 192.168.1.1 cp /etc/boa/default.passwd /etc/boa/www.passwd else ifconfig eth0 $1 netmask $2 route add default gw $3 fi lpc3250/usr/etc/pl2303.ko0000777000175100017510000006234112037445724012563 0ustar 10011001ELFa(B4(GNUy31:v;R1122T 0-L0@0hQS  H0000S@- 0!-? 000@P!=?0  B 0 00  00H  0 @ 0\@ $ 00l, 0-L0 0hQS H0 @0!-? 0000SP  0cP!=?0  B 0 $00S $ 00E|Z 0-L0 0hQS H0 @0!-? 0000SP  0c@P!=?0  B 0 $00S $ 00EZ -LM\2h!0S0  DDD"H00!=?0   0 0S !=?0  B 400|pP0U<p$ ` @dPp1W 00`dW  @f  00  W050%000W !=?0  B 0? =0 00!=?0  B 0 0 @ 0.0K-K\ 0R0 .[0  .K- K0`.K8.K-K^ @ T0 -[0  `H V-K 0 0S 00 (0@P (`(  0, @(KE',Rr 0-LM04Pd" !0  @00@0S 0 @K0Z 0-L@ P0h0S00!-? 000000000000000P!=?0  B 0 00 0-LM0 0@SP H0 0T 0@@R T00xx d# !0@ P $00S 0, K0E-04R p-LM 0`4Pd@0 ` @80@0S ((@ 0`P@Kpx -LM Pp`0d ` P<0@0S 0$$  @ K -L00S ppp p`0hQU @T 0h`0Wp -L$Mp5p0S0`00 h LLL%H0P0!=?0   0S$@54$ 0$0$$0(00!=?0  B 0 $P 4$ @PM/X4h$P @000 ]! @30S  0   00 S0 S000\30S tPP#0 03`0S H  #0V F4F(&0 `@0" 000S "00S "<  " 000S tt"000S PP"|0420S d(("00!0 ] @10S 0!=?0   1 0S000PR !=?0  B 0 00 !=?0  B 0 00! 0 ]@00S  0   pX0 0S0 0 aA-V   (K Ѐ.Ja| -LM@!` PR H0!@1|!TR0S xhh!H0hq0!-? 000P!=?0  B 0 M0‐?@4 00 @`0 000+ 0!000P!00C00 Y0(  Z V 4 R  0S 00 $(K\T9 -LM\2p0Sh DDD"H0P0!M?@0000 @0 А 2 @K< 80 a 0 0S$  0cP V 0000 0S!00C00 `P0!000=?0 00 @K R 00!=?0  B 0 KP}P00S  pPX $00  0!=?0   00!=?0  B 0 0](KEL [ -L8Mp1@0pS`hQ TTT!H00S 00p00   W H K>00S  p 0(0pPP M/0x00S ll P0( PPP 80@M/P FK{ -L M2`P 0tP w1@S P P@20S 44 0 ) 2pPb !@P 1XPP@+ T@E0 0 0 hq00 lR 0 XR L' 04I 0(D 0 ?  06 0 1  X D $  0 P1` 0hq@T 06h00UP (K1Ѐ -L h -LM<@P 000 @P$hIPpl2303_write_bulk_callbackpl2303_sendpl2303_read_bulk_callbackpl2303_read_int_callbackset_control_linespl2303_tiocmgetpl2303_chars_in_bufferpl2303_break_ctlpl2303_set_termiospl2303_ioctlpl2303_write_roompl2303_writepl2303_closepl2303_openpl2303_shutdowndebug<7>%s: %s (%d) drivers/usb/serial/pl2303.c<7>%s: %s - result = %x <7>%s: %s - port %d <7>%s: %s - returns %d <7>%s %s: %s - length = %d, data = %.2x <3>%s %s: %s - failed submitting write urb, error %d <7>%s: %s - urb shutting down with status: %d <7>%s: %s - Overflow in write <7>%s: %s - nonzero write bulk status received: %d <3>%s %s: %s - failed resubmitting write urb, error %d <7>%s: %s - port %d, %d bytes <7>%s: %s - nonzero urb status received: %d <3>%s %s: %s - usb_submit_urb failed with result %d <7>%s: %s - urb status = %d <7>%s: %s - port is closed, exiting. <7>%s: %s - caught -EPROTO, resubmitting the urb <3>%s %s: %s - failed resubmitting read urb, error %d <7>%s: %s - unable to handle the error, exiting. <7>%s: %s - tty_flag = %d <7>%s: %s - value = %d, retval = %d onoff<7>%s: %s - turning break %s <7>%s: %s - error sending break = %d <7>%s: 0x%x:0x%x:0x%x:0x%x %d <7>%s: 0x%x:0x%x:0x%x:0x%x %d - %x <7>%s: %s <7>%s: %s - port %d <3>%s %s: %s - out of memory. <7>%s: 0xa1:0x21:0:0 %d - %x %x %x %x %x %x %x <7>%s: %s - data bits = %d <7>%s: %s - baud = %d <7>%s: %s - stop bits = 2 <7>%s: %s - stop bits = 1 <7>%s: %s - parity = odd <7>%s: %s - parity = even <7>%s: %s - parity = none <7>%s: 0x21:0x20:0:0 %d <7>%s: %s (%d) cmd = 0x%04x <7>%s: %s (%d) TIOCMIWAIT <7>%s: %s not supported = 0x%04x <7>%s: %s - shutting down urbs <7>%s: %s - submitting read urb <3>%s %s: %s - failed submitting read urb, error %d <7>%s: %s - submitting interrupt urb <3>%s %s: %s - failed submitting interrupt urb, error %d <7>%s: device type: %d pl2303<6>pl2303: Prolific PL2303 USB to serial adaptor driver parm=debug:Debug enabled or notparmtype=debug:boollicense=GPLdescription=Prolific PL2303 USB to serial adaptor driveralias=usb:v05ADp0FBAd*dc*dsc*dp*ic*isc*ip*alias=usb:v07AAp002Ad*dc*dsc*dp*ic*isc*ip*alias=usb:v11F6p2001d*dc*dsc*dp*ic*isc*ip*alias=usb:v058Fp9720d*dc*dsc*dp*ic*isc*ip*alias=usb:v050Dp0257d*dc*dsc*dp*ic*isc*ip*alias=usb:v0731p2003d*dc*dsc*dp*ic*isc*ip*alias=usb:v0E55p110Bd*dc*dsc*dp*ic*isc*ip*alias=usb:v0413p2101d*dc*dsc*dp*ic*isc*ip*alias=usb:v079Bp0027d*dc*dsc*dp*ic*isc*ip*alias=usb:v10B5pAC70d*dc*dsc*dp*ic*isc*ip*alias=usb:v078Bp1234d*dc*dsc*dp*ic*isc*ip*alias=usb:v0745p0001d*dc*dsc*dp*ic*isc*ip*alias=usb:v11F5p0005d*dc*dsc*dp*ic*isc*ip*alias=usb:v11F5p0004d*dc*dsc*dp*ic*isc*ip*alias=usb:v11F5p0003d*dc*dsc*dp*ic*isc*ip*alias=usb:v11F5p0001d*dc*dsc*dp*ic*isc*ip*alias=usb:v04E8p8001d*dc*dsc*dp*ic*isc*ip*alias=usb:v11F7p02DFd*dc*dsc*dp*ic*isc*ip*alias=usb:v6189p2068d*dc*dsc*dp*ic*isc*ip*alias=usb:v0731p0528d*dc*dsc*dp*ic*isc*ip*alias=usb:v1453p4026d*dc*dsc*dp*ic*isc*ip*alias=usb:v2478p2008d*dc*dsc*dp*ic*isc*ip*alias=usb:v0584pB000d*dc*dsc*dp*ic*isc*ip*alias=usb:v0DF7p0620d*dc*dsc*dp*ic*isc*ip*alias=usb:v0EBAp2080d*dc*dsc*dp*ic*isc*ip*alias=usb:v0EBAp1080d*dc*dsc*dp*ic*isc*ip*alias=usb:v056Ep5004d*dc*dsc*dp*ic*isc*ip*alias=usb:v056Ep5003d*dc*dsc*dp*ic*isc*ip*alias=usb:v0547p2008d*dc*dsc*dp*ic*isc*ip*alias=usb:v0557p2008d*dc*dsc*dp*ic*isc*ip*alias=usb:v04BBp0A0Ed*dc*dsc*dp*ic*isc*ip*alias=usb:v04BBp0A03d*dc*dsc*dp*ic*isc*ip*alias=usb:v067Bp0609d*dc*dsc*dp*ic*isc*ip*alias=usb:v067Bp0612d*dc*dsc*dp*ic*isc*ip*alias=usb:v067Bp0611d*dc*dsc*dp*ic*isc*ip*alias=usb:v067BpAAA0d*dc*dsc*dp*ic*isc*ip*alias=usb:v067BpAAA2d*dc*dsc*dp*ic*isc*ip*alias=usb:v067Bp1234d*dc*dsc*dp*ic*isc*ip*alias=usb:v067Bp04BBd*dc*dsc*dp*ic*isc*ip*alias=usb:v067Bp2303d*dc*dsc*dp*ic*isc*ip*depends=vermagic=2.6.27.8-svn48-dirty3 preempt mod_unload modversions ARMv5 Kq3Hstruct_module'xusb_serial_resumeb_cusb_serial_suspend6 usb_serial_disconnectv8usb_serial_probeS$param_get_bool%param_set_bool usb_register_driverusb_serial_register4init_waitqueue_head*usb_clear_haltdefault_wake_functionY@usb_kill_urb\ schedule_timeout_interruptible"r6remove_wait_queue?,schedule_timeoutLadd_wait_queue1!__divsi3interruptible_sleep_on{malloc_sizes~gtty_std_termiostty_encode_baud_rate3tty_get_baud_rate$tkmem_cache_allocwtty_termios_hw_change zkfree usb_control_msgBtty_flip_buffer_pushWutty_insert_flip_string_flags‡tty_buffer_request_room} Ƕ__wake_up!husb_serial_port_softint^!usb_submit_urbrdev_driver_stringcfmemcpy __umodsi3ɰCpreempt_schedulecsprintkDLL8usb_serial_deregister3lkusb_deregisterII{#{{4{{{{{   W G nPnP  x$ S&@1(ah E4p'!U 1  W  *pl2303GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2Aaeabi.symtab.strtab.shstrtab.note.gnu.build-id.rel.text.rel.exit.text.rel.init.text.rodata.rodata.str1.1.modinfo.rel__param__versions.rel.data.rel.gnu.linkonce.this_module.bss.comment.note.GNU-stack.ARM.attributes4$2X!. Fx<"(8 O KD"hG 8OHV"^2#mG*z1v O  1 ;L O@@@ hPAABApAAxP  \I4  X  D < (l,<Tht x|Hl HTp tx| 4 T l |  8 L X l             8       4 H        0D`l ptx|  $(<|  \ 8H LP @ 4<Dl`0l lt  < @tHPht0 48<@L0@t |  (!8!l!t!|!!! !!  $ ,<HT X \`d  $ l | ZFVR+NJ=;/3'     ( h*h8$HNl]$$t|t lp D A-  lG'VhZw,,HTT +08 GPPS b!qhT}       4  @9 4y+ + + ,+ ;%+ JP+ Y{+ h+ v+ + '+ R+ }+ + + + )+ T+ + + + ,+ :++ HV+ V+ d+ r+ + -+ X+ + + + + /+ Z+ + + + (+ 61  G   T:E d|@( ",@hL^m4&6EL^m !7pl2303.cpl2303_exit$a$dpl2303_driverpl2303_devicepl2303_tiocmgetdebug__func__.16409pl2303_chars_in_buffer__func__.16063pl2303_write_room__func__.16024pl2303_send__func__.15915pl2303_write_bulk_callback__func__.16742pl2303_write__func__.15984pl2303_read_int_callback__func__.16641pl2303_read_bulk_callback__func__.16675set_control_lines__func__.15900pl2303_tiocmsetpl2303_break_ctl__func__.16560pl2303_vendor_writepl2303_vendor_readpl2303_shutdown__func__.16575pl2303_set_termios__func__.16108pl2303_ioctl__func__.16542pl2303_close__func__.16235pl2303_open__func__.16327pl2303_startuppl2303_init__mod_debug1182__mod_debugtype1181__param_debug__param_str_debug__mod_license1179__mod_description1178id_tablepl2303.mod.c__mod_alias106__mod_alias105__mod_alias104__mod_alias103__mod_alias102__mod_alias101__mod_alias100__mod_alias99__mod_alias98__mod_alias97__mod_alias96__mod_alias95__mod_alias94__mod_alias93__mod_alias92__mod_alias91__mod_alias90__mod_alias89__mod_alias88__mod_alias87__mod_alias86__mod_alias85__mod_alias84__mod_alias83__mod_alias82__mod_alias81__mod_alias80__mod_alias79__mod_alias78__mod_alias77__mod_alias76__mod_alias75__mod_alias74__mod_alias73__mod_alias72__mod_alias71__mod_alias70__mod_alias69__mod_alias68__mod_alias67__module_depends____versions__mod_vermagic5usb_serial_port_softint__this_moduleparam_get_booltty_flip_buffer_pushusb_register_drivercleanup_modulememcpykfreeschedule_timeout_interruptibleadd_wait_queuetty_termios_hw_change__wake_upinit_waitqueue_headinit_moduledev_driver_stringusb_clear_halt__mod_usb_device_tableschedule_timeouttty_std_termioskmem_cache_allocusb_serial_disconnectusb_submit_urb__umodsi3tty_insert_flip_string_flagsusb_serial_suspendpreempt_scheduleusb_control_msgparam_set_boolprintktty_get_baud_rateusb_deregisterdefault_wake_function__divsi3tty_buffer_request_roomusb_kill_urbinterruptible_sleep_onremove_wait_queuemalloc_sizestty_encode_baud_rateusb_serial_probeusb_serial_registerusb_serial_deregisterusb_serial_resumelpc3250/usr/etc/playerDrv0000777000175100017510000000116613635025736013200 0ustar 10011001#! /bin/sh # # Copyright (c) 2001-2002 SuSE Linux AG, Nuernberg, Germany. # All rights reserved. # # /etc/init.d/boot.spi # ### BEGIN INIT INFO # Provides: central_driver # Required-Start: # Required-Stop: # Default-Start: 2 3 5 # Default-Stop: # Description: Load central_driver driver ### END INIT INFO device=playerDrv case "$1" in start) echo -n "Loading ${device} driver " insmod /opt/lpc3250/usr/etc/${device}.ko ;; stop) echo -n "Unloading ${device} driver " rmmod ${device} ;; status) exit 1 ;; *) echo "Usage: $0 {start|stop|status}" exit 1 ;; esac lpc3250/usr/etc/webconf0000777000175100017510000000035512303307246012640 0ustar 10011001#read devtype if [ $1 = "4" ]; then #echo "broadcast node" ln -s /opt/lpc3250/usr/www/page_node /var/www else #echo "central control" ln -s /opt/lpc3250/usr/www /var/www fi ln -s /opt/lpc3250/usr/www/cgi-bin /var/www/cgi-bin lpc3250/usr/etc/gpio0000777000175100017510000000114113635025736012157 0ustar 10011001#! /bin/sh # # Copyright (c) 2001-2002 SuSE Linux AG, Nuernberg, Germany. # All rights reserved. # # /etc/init.d/boot.gpio # ### BEGIN INIT INFO # Provides: gpio # Required-Start: # Required-Stop: # Default-Start: 2 3 5 # Default-Stop: # Description: Load gpio driver ### END INIT INFO device=gpioDrv case "$1" in start) echo -n "Loading ${device} driver " insmod /opt/lpc3250/usr/etc/${device}.ko ;; stop) echo -n "Unloading ${device} driver " rmmod ${device} ;; status) exit 1 ;; *) echo "Usage: $0 {start|stop|status}" exit 1 ;; esac lpc3250/usr/etc/vs10xxDrv.ko0000777000175100017510000002021613635025736013462 0ustar 10011001ELFa(4(GNU5:peiHN H -LX@P0P` @p  U@$@@ -LM`pP 0S 00 00|P@@ 000'$0 0L p0040@$00$00@@ -LMP`@P@0S 00 00p0 000 `0@ 0 00 $00$000 0 0K 0Q0B[[0  K(@ -LMpR@ 0S 0  됀`㔐Pf U P# P2P 00T $00$00`V: 0  (@ -LMH@0S 8 %(+00 0-LxP@Td P "+P 4(+0000 -LMQ K=?0 R@1J#0  003S @T ,  ZP -LMQ@ 00 -LM8@8  0 -LMTL"Lx0H 0x0x0<110 0 00 200 0 0 00` K0QP 4 000<͠@Pp͌ ll!0@@T p$@(@,@0@4`8`D`H`L`P, P00`0 X 0 0  @! @T*P@ @ @"+Hh0T@K@Ecn8vs10xx dreq time out , reset the chip. <1>vs10xx_check_dreq is low <1>error getting DMA region. dma_ssp_tx<1>Error setting up SSP TX DMA channel <1>init SPI DMA FAIL <1> ReadVs10xxRegister(0) : 0x%x <1> ReadVs10xxRegister(3) : 0x%x vs10xxlicense=GPLdescription=User mode SPI device interface for vs1053bauthor=zrw, depends=vermagic=2.6.27.8-svn686-dirty6 preempt mod_unload modversions ARMv5 Kq3Hstruct_moduleOuplC*lpc32xx_dma_ch_disable'lpc32xx_dma_flush_llistnEmisc_registeri@lpc32xx_dma_alloc_llist3lpc32xx_dma_ch_getJ_dma_alloc_coherentZ,dma_free_coherentlpc32xx_dma_ch_putmlpc32xx_dma_dealloc_llistmisc_deregisterdO__copy_from_user^__memzerocfmemcpy__const_udelay8Alpc32xx_dma_queue_llist_entry]j2downcsprintkmsleep@{ vs10xxDrvGCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2Aaeabi.symtab.strtab.shstrtab.note.gnu.build-id.rel.text.rel.exit.text.rel.init.text.rodata.str1.1.modinfo__versions.rel.data.rel.gnu.linkonce.this_module.bss.comment.note.GNU-stack.ARM.attributes4$2X. 0<X8 D8KPG |V2e n }y t0 @@  Bp9 4PHHTP`PpF8E@FLPTAHF0E8F@PAFN$?dElFNAI :pI :IO0IT \:LD<9 M(K<GHIP TICHIL@\Hl>KGHNP P $,J8DHP\Hl tA,  ;,"PXB=     t"l%tt"T?`P`"X"nl"{""TX"P "l`@`"  7 C  l "" 2^  C " PgF `px@ X  (-?FP^qvs10xxDrv.cvs10xx_check_dreq$a$dvs10xx_write_sci_registervs10xx_read_sci_registervs10xx_write_sdi_datavs10xx_closevs10xx_drvvs10xx_openvs10xx_writevs10xx_drv_exitvs10xx_devvs10xx_drv_initvs10xx_dma_spi_tx_irq__mod_license718__mod_description717__mod_author716vs10xx_fopsvs10xxDrv.mod.c__module_depends____versions__mod_vermagic5misc_deregistergBuffer__this_moduleupcleanup_modulelpc32xx_dma_alloc_llistmemcpylpc32xx_dma_ch_getsspiobaseinit_moduledma_alloc_coherentlpc32xx_dma_ch_disablelpc32xx_dma_queue_llist_entrydowndma_free_coherentprintk__memzeromisc_registerlpc32xx_dma_ch_putlpc32xx_dma_flush_llistlpc32xx_dma_dealloc_llist__const_udelay__copy_from_usermsleeplpc3250/usr/etc/playerDrv.ko0000777000175100017510000001003113635025736013577 0ustar 10011001ELFa($4(GNUR6c_ -L0P   -L 0S0C0 -L -L"$ xR`0P=?00  003S 0$0x@ -LM0@@ -LM0@@0@license=GPLdescription=User mode idste player device interfaceauthor=zrw, depends=vermagic=2.6.27.8-svn686-dirty6 preempt mod_unload modversions ARMv5 iDst_ctrlKq3Hstruct_moduledO__copy_from_usernEmisc_register^__memzeroUPSetNetLinkUserPidmisc_deregister|playerDrvGCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2Aaeabi.symtab.strtab.shstrtab.note.gnu.build-id.rel.text.rel.exit.text.rel.init.text.modinfo.rodata.str1.1__versions.rel.data.rel.gnu.linkonce.this_module.bss.comment.note.GNU-stack.ARM.attributes4$2X. 0<`88 K@G V_2 n}y  8 @ <  BBpBRL `. m( T 531 .(10 4(44 8 </(<LT20    ,(',,,T4XX?80IV _ljr@4|  4@( l  h   qF @ 8&8@DN\central_drv.cctrl_open$a$duserCntctrl_releasectrl_writectrl_exitisDrvActivedctrl_devctrl_ioctlUserPidctrl_init__mod_license375__mod_description374__mod_author373drv_fopsplayerDrv.mod.c__module_depends____versions__mod_vermagic5misc_deregister__this_modulecleanup_moduleSetNetLinkUserPidinit_module__memzeromisc_register__copy_from_userlpc3250/usr/etc/vs10xxDrv0000777000175100017510000000115013635025736013046 0ustar 10011001#! /bin/sh # # Copyright (c) 2001-2002 SuSE Linux AG, Nuernberg, Germany. # All rights reserved. # # /etc/init.d/boot.gpio # ### BEGIN INIT INFO # Provides: vs10xxDrv # Required-Start: # Required-Stop: # Default-Start: 2 3 5 # Default-Stop: # Description: Load gpio driver ### END INIT INFO device=vs10xxDrv case "$1" in start) echo -n "Loading ${device} driver " insmod /opt/lpc3250/usr/etc/${device}.ko ;; stop) echo -n "Unloading ${device} driver " rmmod ${device} ;; status) exit 1 ;; *) echo "Usage: $0 {start|stop|status}" exit 1 ;; esac lpc3250/usr/bin/0000777000175100017510000000000012326427475011275 5ustar 10011001lpc3250/usr/bin/boa0000777000175100017510000073206112760766020011767 0ustar 10011001ELFa(4_4 (%"444ddddd4Axxx((( Qtd/lib/ld-linux.so.2GNUar'5g?6oep nBYlHD=9Kkdm%`4q Q)O/XfTZE20aR.h#1 <JN;  +>WU@C-,:[*(8 F$"7&ASPVL\Ib!c3_MG]^ijtk|B%ȔԔGD  (4@LSX]dp|ENwsmĕЕܕs BpY;$0^<H,TK`l_xLZ-̖Qؖv d{ ,8fDXP\ht3ȗԗ~6&(4@LVX"dp|>h4ĘИ2ܘ}o e$0T<lHT`l>xlibcrypt.so.1__gmon_start___Jv_RegisterClassescryptlibc.so.6_IO_stdin_usedsetuidchrootsocketstrcpyexeclreaddirfopenstrncmpinet_atonstrrchrpipe__strdupperrorconnectgetpwuidsendfileclosedirinitgroupsinet_ntoastrncpyforkunlinklistenselectreallocabort_exitmemchrgetpidmkstempgmtimestrtolmmapsyslogfgetsgetpwnamcallocstrlensigemptysetmemsetstrstr__errno_locationbindfseekchdirreadmemcmpgetsockoptherrorgetoptdup2longjmp_setjmpsigaddsetgetgrnamstdoutfputcfputslseekmemcpyfclosesetsockoptmallocumaskstrcasecmpgetgidtzsetopendirgetenv__ctype_b_locsscanfoptargstderrmunmapgethostbynamegetuidexecvestrncasecmp__fxstatgethostnamefwritesigactionmadvisewaitpidlocaltimestrchrfprintfgetsocknameaccept__ctype_toupper_loc__ctype_tolower_locsetvbuffcntl__xstatgetrlimitmemmoveaccesssetgidstrcmp__libc_start_mainsnprintffreeGLIBC_2.0GLIBC_2.2GLIBC_2.3GLIBC_2.1 ii 8ii ii ii ii 9YfTX\`dhlpt x |    !"#$&'()*+,-./0 12345 6$7(8,:0;4<8=<>@?D@HALBPCTDXE\F`GdHhIlJpKtLxM|NOPQRSTUVWXZ[\]^_`abcdeghijklmnopq-Y51-}ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ$  --0-XxX-00 0S|xX0p@-0SpH H0`0bC1@C8P 0S :0 plp- -0S0S3/t-@-Tp`PU P P @PTP`DV%0@-@P! PU  R /R 0/R  0RT0""20 c08?4 40 0 <0 tY]Y|Y$=O- M/R $ЍC% P( |0@aVY  PX*0I`VN 0 |x,0 PX:@  @P0T/S 0/SS0Y (,000eSK t 0( C c%j0S 0Sd +?$  0`Vl[0S `; ~Re T;PUn $I`$Fp 0 @0 p;*0 0SJ -/P$ P&0 0P0 P  P P@ ^L Pp 0SZ ;d9$)01B*: # 29 # Pc0@TB (CM'@ A/O`P 00/00pW @V, ,  0 ) 0S ,0 /00V  (0 ~d(0 O#)P@ l88@T @ p@p080y0('000e 0S  008%%\tY]\\X],]]<]O-ȵM`?P y=p@ p xExxxul%p5 c0@S80P$PPPPPPPPPPt5 5%=p  p pS,%$pD0S p  * XpP +p  p  4p 4 p 3p s#: 0SY @tx T/ 3P G`P  u.0S 00mkP Pb4(M$#$3iQI #3cF:P# b0SBB0S n2 0=%T*2@  @@'Ѝe@pB`Pq pf D2jp[ pQ 0S p "2 h 0P-  P=Z!1d|!1Pd!1AL!1L4h!x1/P!d1#0PV/@Q*4MP( $1 1 0 0,00 P]8QQ^`^^D^H^P$Q,Qtm ^]T`]]`QQ `xQPt`__^^\`__T__ __<^(^_____^0P0/E-`P4@00V00S(V* P%p Tڀ2  2 SW000 RW 0 0 P00F`_dQ`00@- SPPL \ P0L0P0 0I0 S @P@L@D 0P@0 0pPL0PL`P O-0@0ZbS&pt;`p" C) U'Rx@,PE0@0S" C0 cP0S i0  00 0pg  PE` 0pl  0p amPE` 0pq uo00PE``E-@P 0\`Zb%p Uڀ2 PE ,2 SW000 RW 0 0PE @\0cP0S $ 01 G 00dQ`p@-@` PP 0 S P0 S  P0PpPp P0 :c $ 00paO-QMp p @`PP  =00  00Ѝ#(~  0  0n`ta@-4P@p`0 R s0`@T&\S@-PPc\M@`p `P U  \ > 0 a\ b X0UP0D L 0pЍS  $0M anaa0 SG- M`cT8  \0S@@ \0@S 8. 1(0S5 S, pp@ P00CSWpi \ p x7 R 0S Wߍ@@0T/S!p +kpp ,*Ɵ0P 0= $0P Q& Q& 6Q& 0:P ` R d01P P 0*P 40 !P C-% 0P x R 0P | R 0P  0P R 0P}  0Pv n h0 Pm 0S 0S\0dS> 0 !X $0@ W WQ iEp 10"S0( 0 00@ D 6 0005 $0d ~'$ P'tl0t0/PP @OPy00-Po@Pf .0/ 0  @>0  @0D0 0S7 33P-PU @PT P =pP 0 0-( 8 2 %@0P/S "20 tNtt"C=%0 Pw ts `{W @P 1 (P iW  t1 W  0P{ R> 0CPr R 0Ph` =/PP p +P@ @TPQpW00 S P; L 0% 0 P01PL%tccc &&Tb\bdbhbpbbbbbbbbbbb0ccdc tQdn|dddLQHddcdc$ccc8dTdQ@-`p0P0@P$  P@ 1S 008#80 8dRC8 !؁DD D0@7 0y, 002 t 0, &&cf\e,edO-o00Pg 1 PPp@H$HX @h@H$HFhE1 @x@H$HGxXEX\T @@H$HhFh0,1@@H$Hr XEX0 @p@H$H8C8 S@!0S  R 0B x4t t0 T d0" &&XXX!X14!L0O  0 !,10 0 0% 00  0N u8Q&di%Pj Qj$PPQ Q@QQtk0QQQ4jjPhamk$kR|kjijTjjjtj0@-XMPhQ 00 SP@  03R  10 1PQXЍ0mdQO-@MPMUpi `@00 SZP ` <p@ C  % 2Ѝڍ%` V Vd p0 0P0` v@P@ P %| 0S@ @3@T 0 P0 cT`8Yn(30S #@p@  @0 RVvM`p@k `P >P} C=%0 t 0il @ dPP @ 0.S4 0(@P QPP @9 B@ 1 @ ,@hp@>   `@*C @ %$ 0S .S 0S DA 00@0F 60S S 0@($@@P|0 tPlc@HQ\nnnnLQnnQnt~tm8oloooQo nd`no(on o 0p@-S M: 0  00a!0 0S mPP @ 0`0 8`PP 40 040 0bs  Ѝp 001l0@d 0 S ( 00Q?Qp$pO-MM@t`Pm YP ɍ0: So  SA0TQ  .PPQ l0 S0,0X  0Sl00,Pl0U7  0S F0P ,P U0(@ 00 @T l0S 0 )P@ &0& @Ѝٍ0S@@U Pln Ug d@@@0T/SQ ( 6RCp%006 PPQp0Sp5 PRP  張 0 00 SPB@@Do j:0  0  a0 X 00@ ş /00 Ad@|@x@jrP 74 00@c 00@ tPJ  0SD  80S9 : P0ɍ:c0  R3 0 aQ5PP9P 80C00 40 0 P400 0 RP0P @<@ *P 0(@0 0800 Sp{M8@@D  ɍ0A=Cp0Cppz 00P g 8@/@P@y P {xo 0S @ꀡ 0 S9@@Dhf a [ 0$ / 0 @|T@PpT})0:( j00@ mj@`DPI@W 00X @PLMp4q(&P$Q,&p$pQQ\nnD,pqpLpG-Qp`PU @PTpZ`/&/0&P0@- \d0dP  ,0A\H Q$0-$ 02 00ŝDq- 2@c`]ALp@-PQA `V 8P @Tp@ 0@5 0p 0, @qxq0@-@0S 0 S@QhP `@T0S 0 S@Q 0@0&q&rE-PRMpa @TG Se @TJ  %AT 0S @PЍ {`P: P0U I P T`a@@S|@PP P 09@i 02 2a 04 *xt 0"@RP l0. @I, L00 @@@P%s,st`s`rr4s0rr0@-Pl0dB32C0d @c P 0IP 0 YP0]AL&0P@-" 0S .\P 0@S 0t t0. X0 HP00 (0- 0Qs0&s0@-P@ 0 P0 00@0&,sts0#/@-@`pW0SP` K000@-0M00Q 000P@0 $("48#8"<  0MЍ0$00@-@P0 0@X tE- Mp}1 R%@0SP' p0PS  ?0S ``P <@\UPT@ 00) Ѝ`Pd !H@P<@8 \T@0 @0PQP,t(t4tXtG-M`+<0P@p~0( p zpЍxtG-M`80@Ppd0$  p`9xt0@-@PR 0P00@-@PnK0@ 0p@- MR` 0 R0 R p0|Sx-<0hdd@S0\TP@4`` @ 0zЍpuDQPQP,t(ttt1p@-P @Pp)pe s1PZ @TPp:  p? tQ]P \ap  p <1 0\(1 0p@U1T !?000Z 04@@-@I 0A XpL 06pEl x00lK@D:@ T0%,5( @0(QDQTQtQdututu u4ut]ttP-0S P0  D0 @0CS0 * 00C0%u'"O-0 ppM0 0 @@ T1 R8"0h`V,  0R 0R000![ ,0R1    1 0눡0ht ЍpX0S,  0`p6 , p 1  0 h0 0 0,0000 0 0 \@P| 0 KxP ,s@Pp4 0@ 9P4'''%u'Tv0vLvv(v 0p@-S@T 0P Pa<`UPU(0SLPP(PPPLPpL tp85 PD P 004p <P7P (wp` P P" 00kpP& P  0bsP p@L04 0U L004 P0L0pPLPp 00e(Bp((`PLvv|v@D0p@-`S@ 0Sp0 D0@0p pP @04 0 V@04 p PpP 00, pv 0@-SMP7 X!0@00dS`1`!V pT 0@.(0S@3 P0 P P PhP 00Ѝ 40040 0 Rnp 00 0H @, 000  !?wvvDC=%0 S@-@  R0000 @(pP) D 0P0 Dp0 SD @`P) 0 0 @oQ0000D 0C0@`@)P P 00u$RP꬀(wfp-0 AP1 1 Q 000Q 000  P0 Q S0 00CSP`@ \` !0!U !Pp/P0@tP@(P@??66RP0R @-0AP1 0 Q 000Q 000  P0 Q S0 00CS X01"001/ ,t ( ??66R0R0SL0 H0 Q4 00(0Q 00 000/66 R 00  0 /66 @-R ,@0 S0 0/? 00/?,0 SG- @` Ta  0 @S  RU d1 T!0L TF ((p 08W @PpU @0) r,0 ,0R:0C0q QP*W000 P @ , 0t,0 0b0,  B D  00{ ?%wTw4wwT @-@T00 0000 o@P: 0k?wywO-xMl  g@P Tx `9Q9xxxxxxph``````````P10C0x!x@0 S1  0A` `S` @S1  0A S0S6 S U" PPPPPVvI ax!0p 0S p $0`0`U$0' 0Sp1 0 V0  R 0 S@ @(00 xЍ 9t0 x /L \0? y R 40 Swx%x x?w@x@- @0S0S?D0@0 aA-p, 0S lRM 0\@0D003053*ЍЍAtP/P00 @0 0 @Z@ 0`00@P0,@  @@0`EX00@,XP T09 P @ P $;%pyhy8y,y@00@-@, D0:0` aS0!S000 lpP P D0 0D0 0L0LH U?S 00 S >00yhyy,H0 0 O-SmSMMP&`$@ SM$@00V:0pVH*@ T T T T 0D_S R $     T  Q  pH0R0H0` R @P 0S Ѝ TC QH0 p0RH0`D0pD @0 c Rw<0S>  PU V@`:0S?*a0B SL*S&@P\#0S*<0S 8#80' 5>0@ T  T T00D`  TD` OP 0SЍO@0S=$0  ;t2xt"60` [@D"P0/ 0.0 @} 2 q@r@0D  cd@e0p0S=&0 W@`D0 I  `P6q0S VK@D0 0`S00 ,`D0F00 00 00S=$0  !1@.P P@' I&>0@A0 @0SHO2X 0 }@&( 0Pw@%Qzyhyzyz$n{z4zz\zp@-(`P P@T00p?6@-@`p:PP 0@0P P P  S S0S00A0CS%lp\ XP H RP0S@0  0@, AP0d@  0P0 2Pc  ,P 0S 0s PP20l PT0ST@0@ P`0S`@0 P0S@0  P0S@0t  P0 R 0S  0P]=p0 h00h@  P0wI`{h{{{{{{ccx{Q{<{p@-<@PTM CM%@ `P4 a $2 /R:2 R `PD pp@TD  p@:P00p@ PB>P00pPp 0SD 0S>00p@X!0P %p8p!0! Ip0sp 00 8p 0 }pp@X P@t  ppLt0t0ppP{ |{@Q,|`|p|E-SM&@<@M`Pb P0 0e<00 @ R@0 S SP P0S Spd W P& P 0 S/S S @Y="0  12+<0ЍC % ?0C=$0  0S00 SK 0S? 02 \  2< ] P0 0  P0 0 1< BO S@ 0S/S/S8T:pdC % `0S80@ S0 S S00  0@P0S0 S0C0 0 {T0< plS Ry R0 t| }p}|&||||}}}(}H}Qp@-@ 0 S]0&P00   0 0 '0@P0pH 0`SS]&P` S]&PS& `QP%}P0E-SM` 0 SXg0 S D#0S*<0S P (PtP0S"%0%0"0%2\ PU> 01r@\0PS@ P \0U\0PS@P xP |P P pP 0S 80 S 0Sn & Q0"1@0@D 0@1ٍ@T0!0CS0S :T0 0C 0TH0à!0 !!P 001 00p 00Y PV( 崠01"t00P1猀c t |01"001W0Sf?0<8PG ,D )C0S8 5?Q0RRxQ&}???PH@-@T ~@P !?64~E-,M,@21d`( (`.pPm  PR$ $`pPP`P 2"S&0@0 pPPD"D2D +p "$2;  p!22 r0SC  0RS: P QA1  Q P'&,ЍL!t1t 0!01TDD0 S $c 1 1  0$PP$0S 0 000 pP 000 d0  B y 00PQ~~~??xQQ?`~x~L~?X~&O-\r0SL2PU@@b 8P0S R RR####""""""!""mp@= P dp@4 T@0S0ST x!@00TPT t  ;p6T/ 0S D)C%j("@6̉PDP0Q.@-0@ P L L0Q8@D 0R@-0@T0RPH0Sk]f@nD$0@-S@U@0Q@-0@ 0QM0$0S xlX@P 0 b4D0@-@ 0 00S 00$0S 0S ,q l 00Dt 0S00/&0 /%0 /%0 /&-4,, 0$ 0 PxQ&@-x0MtPtp `  J@P0S Ds 80g 9@PЍ% &PЊ-,]$ $0" J0 P&-0Ko( 0  80 P Q|0@- t@ p4X0 \"  L0 0pE 0@%P4Pp@-7h0h `0 b\T0T@,000SPP QQPH0@- R 40,@(0( QQP Q@-($@ 0  P Qԋp@-M@`P`%`     - ) % !      Ѝpp@-M@`` {xuro lif Pb _ 0 0 00 00 000 0@ @ d00X0 0 @ @Ѝp88805L56`5t5Q /Q  Q /Q0/S .S0 /S .S0/S00/0A0CS<<<<<<<<<<<<=(=0=<<<8=/0pS/ //0aS/0nS/0rS/ / //00- RP@L %R ?R. #R3  L0 @LR000/ R Q @R070C22  @Q 070C00A0000 C^R0L000U0000U  R R ?R00@-<<@00 1  b0 S l /O-`R@P# pV  R0`b 0P ă,9,&,@?0? ?? 0 V0 P00/E-pPP 9  @AB0S ` a0BSG B00B S +R  -R& Z @AB0S R 3Q D\2U020CR  BZ R00Ƿ? p@-PPP0m @0p0S:x`@ @$T p@h0@-@PT00! @T00@-@P0H00P  [?PQ00 @ -Q08Q#Ƞ00  8C0.Q00^0S @-@p +@@-@p +@~Ƞ@-0P` Lxp@' U! P :/b 0( +@tp!T\ `0 @ 0WC@  Qt?p@-P00  `p `P@ 2P E-@P q 0-S3 pP3 0p0S:x`@e0@T U0  0 0@0T0 pE \0 00pP`0, %Ќ0Lp@-QMP_` Tp:@@!00 c0 0 @ @1  b0000 000!00c00  0v΃ \ @1  b0 S @0 D 00Dh 0D1  b000D0D80 D Ѝp h`Pt(X@-@`T P_p-Tp 0! @TO-00M SSP@ @0 SS S 0Ѝ,`(p$  0 )P%  0 P  0 pP  t0 P X1XT!T1@(@ETd0@(0,1Tv>D 0C(0@p $,`pP. ;W;ZX0FS PF0D2S 0 0dS00eS 0S00hS00jS0gP ÊPÆ$0 ,~|؍lt2E-@T d`"`Ÿ`$O0BdT@d$<2 `!1qQ1 0C `cb0@fX0@000P0 ]00 @P00Cg0 00A:!00c0 0  1  b0000 1  b000 0 v΂ \ ,1  b0 S @/@@0`NN PNNpN@0 !00 c00 [0 0<!@00 ]@ 0000+0XQPOOO(@-:M@*P"  W00 48#8 <0P 0  Z@PЍ  P@@t0@- MPp @P T Ѝ0P 0888 y'sꀏ(]0|S :S i/AO-0M  0SĴ0 0Sd 0C⡢p 0ğ0S0S|$0Sp4@T T Xğ0S D4P 8ğ00ğS,0 S0 0 #0p #0S 1S<p#0 S B 3@T< h0 S'   P2,0"Q !,#U( @@3 ,ß0P(#cP*ß0Q<0S <QP0S00CS5QQQQQOPP]U0S"0Sq TŸ0So D0Sn 84"0Sm $2@Tl828Ÿ 0RW !100 1e   P20"Q1 !ڜ(   P20"Q`1 !Ŋt   P20"Q !~@0SE 0\pFP P@ g!1p: 0O p  1Q 0RRP%%&&&?QP?Q60Q?Q/@-Tp`PU P P @PTP`V,PE-pM`PP܍ @  WP ! <: @ 1R SB5P P -P %P   5P P2A-PMUL C}%p PUF `@ P0 S/R 0C=$0 /R R2@T` `V<  `P) w : p@PS `xOPPT  }@4T! T6 T  ,(1Ѝ 0@P  0  00 l0L0}HuZ,PȏPPЏP @-P`PpP@T 0S @TPU6 ,PĐ@-p`P@pT SP @T@OL0@ 0,P0@- LPLL 0+ 4@ $0  0@e $Q8/G-T``p@ @00bCQ@`  @T:p@-@3/0@Ds`--alias.cfile sent to get_alias_hash_value is NULLfile sent to get_alias_hash_value is emptyuri len is 0!%s:%d - looking for "%s" (hash=%u,len=%u)... %s:%d - comparing "%s" (request) to "%s" (alias): Got it! (%s) Don't Got it! uri too long! nph-unable to strdup req->request_uri for req->script_nameunable to strdup pathname + index for req->path_infounable to strdup buffer for req->path_translatedunable to malloc memory for req->path_translatedunable to strdup pathname for req->pathnamePOST to non-script is disallowed. unable to strdup buffer onto req->pathnameEmpty user-dir in URI htdocsCould not strdup buffer for req->pathname!application/x-httpd-cgiCould not strdup req->request_uri for req->script_name.POST to non-script disallowed. NULL values sent to add_aliasempty values sent to add_alias%s:%d - Going to add alias: "%s" -=> "%s" (hash: %u) out of memory adding alias to hashfailed strdupstrdup of realname failed%s:%d - ADDED alias: "%s" -=> "%s" hash: %u find_aliasget_alias_hash_valueadd_alias/dev/nullboa.ccan't open /dev/nullcan't dup2 /dev/null to STDIN_FILENOstrdup (for server_root)chdir (to chroot)chroot/chdir (after chroot)Usage: %s [-c serverroot] [-d] [-f configfile] [-r chroot]%s [-l debug_level]c:dl:f:r:/etc/boastrdup (SERVER_ROOT)Could not chdir to "%s": aborting unable to create socketfcntl: unable to set server socket to nonblockingcan't set close-on-exec on server socket!setsockoptunable to bindunable to listenfork/getpidfopen pid filegetpwuidinitgroupssetgidsetuidicky Linux kernel bug!Warning: Not running as root: no attempt to change to uid %u gid %u maincreate_server_socketdrop_privsmallocbuffer flushRan out of Buffer space (%d chars left)! [req_write_escape_html] Ran out of Buffer space! [req_write_escape_http] There is not enough room in the buffer to copy %u bytes (%d available). Shutting down connection. tried to allocate (key=value) extra=%u: %s=%s Unable to generate additional CGI environment variable -- ran out of memory! HTTP_Unable to generate additional CGI Environment variable "%s%s=%s" -- not enough space! HEADPOSTGETUNKNOWNREQUEST_METHODHTTP_HOSTSERVER_ADDRSERVER_PROTOCOLREQUEST_URIPATH_INFOPATH_TRANSLATEDSCRIPT_NAMEQUERY_STRINGREMOTE_ADDRREMOTE_PORTCONTENT_TYPECONTENT_LENGTHREMOTE_USERNot enough space in CGI environment for remainder of variables. %s - environment variable for cgi: "%s" cgi.cpipecgi-fcntlfork failedunable to find '/' in req->pathname: "%s" Could not chdir to "%s":chdirunable to malloc for newpathdup2 - pipesdup2 - fdunable to strdup 'q' in create_argv! /usr/bin/gunzip--stdout--decompressUnable to execve/execl pathname: "%s"Forked child "%s" pid %d Unable to allocate memory for common CGI environment variable.memory allocation failure in add_to_common_envfar too many common CGI environment variables added.unable to allocate memory for common_cgi_env/bin:/usr/bin:/usr/local/binPATHSERVER_SOFTWAREBoa/0.94.14rc21SERVER_NAMEGATEWAY_INTERFACECGI/1.1SERVER_PORTSERVER_ADMINCOMMON_CGI_COUNT not high enough. Unable to allocate a component of common_cgi_env - out of memory. add_to_common_envcreate_common_env cgi_header: unable to find LFLF Location: server does not support internal redirection: "%s" Status: HTTP/1.0 Too much data to move! Aborting! %s %d cgi_header.cThis version of Boa doesn't support access controls. Please recompile with --enable-access-control. Setting pointer %p to unity Calling add_alias with args "%s", "%s", and %d config.cCan't open mime-types fileImproperly formatted mime-type: "%s" Group %s = No such group: %s User %s = No such user: %s Setting pointer %p to string %s ..Unable to strdup in c_set_stringdone.skipped.Setting pointer %p to integer string %s .. Integer converted as %d, done Error: %s found where integer expected Checking string '%s' against keyword list boa.confCould not open boa.conf for reading. Line %d: Did not find keyword "%s" Found keyword %s in "%s" (%s)! expected at least 1 arg! (%s) gethostname:gethostbyname:strdup:TMP/tmpInvalid value for single_post_limit: %d Both VHostRoot and VirtualHost were enabled, and they are mutually exclusive. Both VHostRoot and DocumentRoot were enabled, and they are mutually exclusive. defaultgetrlimitDefaultType *must* be set!PortListenBackLogUserGroupServerAdminServerRootUseLocaltimeErrorLogAccessLogCgiLogCGILogVerboseCGILogsServerNameVirtualHostVHostRootDefaultVHostDocumentRootUserDirDirectoryIndexDirectoryMakerDirectoryCachePidFileKeepAliveMaxKeepAliveTimeoutMimeTypesDefaultTypeDefaultCharsetAddTypeScriptAliasRedirectAliasSinglePostLimitCGIPathCGIumaskMaxConnectionsConcealServerIdentityAllowDenyCGIEnvAuthc_add_mime_types_filec_set_stringread_config_filesABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_.!~*'():@&=+$,/?pathname_with_index not large enough for pathname + index.gzstrdup of pathname_with_index for .gz files get.c:568 200 OK-GUNZIP Content-Type: 200 OK Content-Type: text/html %s/dir.%d.%ldopendir failed on directory "%s": opendirdircache fopen Index of %s

Index of %s

 [DIR] Parent Directory
 %s
re-opening dircache%sGot SIGBUS in write(2)! writePathname + .gz too long! (%s) strdup req->pathname for gzipped filename get.c:88Unable to perform simple_itoa conversion on server port!buffer not large enough for directory redirecthttp://Resulting file is not a regular file. Got SIGBUS in memcpy document openAttempt to hash NULL or empty string! [boa_hash]! Yipes! Null value sent as key! [hash_find]! Attempt to locate empty string in hash! [hash_find]! mime_hashtable has %d total entries passwd_hashtable has %d total entries Yipes! Null value sent as key! [hash_insert]! Attempt to hash NULL or empty key! [hash_insert]! Yipes! Null value sent as value! [hash_insert]! Attempt to hash NULL or empty value! [hash_insert]! Adding key "%s" for value "%s" (hash=%u) hash.cunable to allocate memory for hash_insertallocated key or value is NULLAttempt to hash NULL string! [get_mime_type] Attempt to hash empty string! [get_mime_type] Failed to hash_insert mime type.hash_insertadd_mime_type%s%s%s (null)%s - - %srequest [%s] "%s" ("%s"): %s - - %srequest "%s" ("%s"): %s%s:%d (%s) - -%s - - %s"%s" %d %ld "%s" "%s" log.cunable to open error logunable to dup2 the error logunable to open access logcan't dup2 /dev/null to STDOUT_FILENOunable to set close-on-exec flag for access_logopen cgi_logunable to set close-on-exec flag for cgi_logopen_logsmmap_list(%p)->use_count already zero! Old mmap_list entry %d use_count now %d (hash was %d) Unable to mmap file: mmapUnable to madvise file: madviseNew mmap_list entry %d (hash was %d) ioshuffle lseekioshuffle readioshuffle writepipe writeimpossible offset (%lu) requested of sendfile bad craziness in sendfile offset, returned %ld sendfile writepipe readrange.c: ranges_fixup: %lu-%lu start or end of range is invalid. skipping. ending with start: %lu stop: %lu ranges_fixup returning 1 range.cran out of memory for new Range...bytes=range "%s" doesn't start with "bytes=" Invalid range request "%s". Invalid range request (neither start nor stop were specified). range.c, range_add: got: %lu-%lu !c!DDrange_pool_popwrite body%s:%d - wrote %d bytes of CGI body. %ld of %ld read.c%s:%d - wrote %d bytes (%s). %lu of %lu read body%s:%d - Premature end of body!! %s:%d - Parsing headers ("%s") Illegal character (%d) in stream. Header too long at %lu bytes: "%s" Invalid Content-Length [%s] on POST! Content-Length [%d] > SinglePostLimit [%d] on POST! Unknown Content-Length POST! No space left in client stream buffer, closing header readclient unexpectedly closed connection. %s:%d -- We read %d bytes: "%s" header "%s" does not contain ':' ACCEPTAUTHORIZATIONCONNECTIONKeep-AliveHOSTIF_MODIFIED_SINCEREFERERRANGEUSER_AGENTNo logline in process_header_end URI contains bogus characters URI does not begin with '/' unable to strdup default_vhost/req->header_host host invalid! unable to set close-on-exec for req->post_data_fd!Request too short: "%s" GET HEAD POST malformed request: "%s" URI too long %d: "%s" httpbogus absolute URI no URL in absolute URI: "%s" Error: corruption in absolute URI:"%s". This should not happen. HTTP/%u.%umethod is HEAD but version is HTTP/0.9bogus HTTP version: "%s" req: %p, offset: %u Warning: CGI Environment contains NULL value(index %d of %d). malloc for new requestrequest.cacceptGot fd >= FD_SETSIZE.getsocknameascii_sockaddr failedfcntl: unable to set new socket to non-blockfctnl: unable to set close-on-exec for new socketgetsockopt(SNDBUF)setsockopt: unable to set socket buffer sizeUnknown status (%d), closing! Unknown retval in process.c - Status: %d, retval: %d get_requestHTTP/1.0HTTP/0.9HTTP/1.1Content-Range: bytes Connection: Keep-Alive Keep-Alive: timeout=, max=Connection: close Content-Length: Accept-Ranges: bytes 505 HTTP Version Not Supported Content-Type: text/html; charset=ISO-8859-1 505 HTTP Version Not Supported

505 HTTP Version Not Supported

HTTP versions other than 0.9 and 1.0 are not supported in Boa.

Version encountered:

strdup of _body_len from simple_itoa 503 Service Unavailable 502 Bad Gateway 502 Bad Gateway

502 Bad Gateway

The CGI was not CGI/1.1 compliant. 501 Not Implemented 501 Not Implemented

501 Not Implemented

POST to non-script is not supported in Boa. 500 Server Error 500 Server Error

500 Server Error

The server encountered an internal error and could not complete your request. 416 Invalid Range Content-Type: text/html; charset=ISO-8859-1 414 Request URI Too Long Content-Type: text/html; charset=ISO-8859-1 414 Request URI Too Long

414 Request URI Too Long

Your client has issued a malformed or illegal request. 412 Precondition Failed 412 Precondition Failed

412 Precondition Failed

404 Not Found 404 Not Found

404 Not Found

The requested URL was not found on this server. 403 Forbidden 403 Forbidden

403 Forbidden

Your client does not have permission to get URL from this server. 401 Unauthorized WWW-Authenticate: Basic realm="401 Unauthorized

401 Unauthorized

Your client does not have permission to get URL 400 Bad Request 400 Bad Request

400 Bad Request

Your client has issued a malformed or illegal request. 302 Moved Temporarily 302 Moved Temporarily

302 Moved

The document has moved here. 301 Moved Permanently 301 Moved Permanently

301 Moved

The document has moved 503 Service Unavailable

503 Service Unavailable

There are too many connections in use right now. Please try again later. 416 Invalid Range

416 Invalid Range

Content-Type: multipart/byteranges; boundary=THIS_STRING_SEPARATES 206 Partial Content 204 NO CONTENT 100 Continue --THIS_STRING_SEPARATES-- --THIS_STRING_SEPARATES Server: Boa/0.94.14rc21 Date: Last-Modified: m,8DT h@t̎ ܎GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2,,LdYxML'd6A 6RU,)gottP8$!d*ThP#05 ;{L0NHxS PXt$\lY=" dump_alias translate_uriadd_aliasmainydebug_levelsighup_flagsigchld_flag sigalrm_flagsigterm_flag.start_time@pending_requestsRbacklogdcurrent_timeM _ reset_output_buffer escape_string req_flushE req_write_escape_html req_write_escape_http- req_write' clear_common_env add_cgi_env init_cgioadd_to_common_envcreate_common_envcommon_cgi_env_countverbose_cgi_logs%62 T process_cgi_headerXA& lookup_keyword read_config_filesaccess_log_nameerror_log_namecgi_log_nameuse_localtimeserver_portserver_uidserver_gid%server_admin7server_rootIserver_name[server_ipmdocument_rootuser_dirdirectory_indexdefault_typedefault_charsetdirmakerpid_filecachedirtempdircgi_path!single_post_limit3conceal_server_identityEka_timeoutWdefault_timeoutika_max{max_connectionsvirtualhostvhost_rootdefault_vhostcgi_umaskconfig_file_nameclist76Rbuild_needs_escapex_needs_escape7Uhj get_dirprocess_gethinit_get)gdump_passwddump_mimeget_mime_hash_valuehash_show_statsget_home_dirPget_mime_typeadd_mime_type>onet_portascii_sockaddribind_servert _ log_error log_error_doc log_error_mesg' log_error_mesg_fatal log_error_time boa_perror log_access open_logs cgi_log_fd-?release_mmap find_mmap\8 T io_shuffle write_from_pipe4 io_shuffle_sendfile read_from_pipe!g block_requestH ready_request dequeue enqueue request_ready request_block- request_free| , ranges_resetv range_pool_push ranges_fixup" range_pool_pop[ range_parse range_pool_empty; T write_body read_body read_header*> free_requests process_option_lineU process_header_end process_logline new_request get_request process_requestsIstatustotal_connections+system_bufsizehA http_ver_string send_r_continue print_partial_content_done print_content_rangeA print_ka_phrasej print_content_length print_http_headers send_r_bad_version/ send_r_service_unavailable send_r_bad_gateway send_r_not_implemented send_r_errorS send_r_invalid_range send_r_request_uri_too_long send_r_precondition_failed@ send_r_not_found send_r_forbidden send_r_unauthorizedsend_r_bad_requestTsend_r_moved_tempsend_r_moved_permsend_r_no_contentYprint_last_modifiedprint_content_typesend_r_length_required send_r_not_modifiedFsend_r_request_okprint_partial_content_continuesend_r_partial_contentcomplete_responsec sigtermsighupsigchldsigalrm+sigalrm_runAsigchld_runvsigterm_stage1_runsigintsighup_runsigterm_stage2_runsigbussigsegv0reset_signalsXinit_signals> envP handle_sigbusU o oclean_pathnamemonth2intunescape_uriBsimple_itoabase64encodebase64decodeprint_debug_usagestrlowercheck_hostQreal_set_nonblock_fdreal_set_block_fdcreate_temporary_fileSboa_atoiparse_debugrfc822_time_bufb to_upper> modified_since get_commonlog_time?{1open_net_fdopen_pipe_fdopen_gen_fdM loop block_read_fdset2 block_write_fdsetD max_fd{&  get_auth_hash_value. dump_auth auth_check_userpassR auth_authorize- auth_check^ auth_add #timestamp/home/usb10132/ct1/bin/targets/arm-vfp-linux-gnu/build/build-libc/csu/crti.S/home/usb10132/ct1/bin/targets/src/glibc-2.7/csuGNU AS 2.19.50.0.1Su x00_int+Z&8h9o500;Sz00I7(v777=27>KXMzl  {# |7# | -< >#  # . # o #  #  #  #  # D #  #$  #(   #, "z#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P#l Aq z z# b# >#C|  <  '=X %  &# 9 'L#  )#  -#  .#  /# , 0#  1# @ 2L#( \ 4#, R 8#0 m ;#4 # FC#8 GC#@ J HC#H  US#P  VS#T \_}P  "^Lj %oc}x   6 w 0j#uCQ,}=W|K ! I T WN Z_@ ]NPHCGI ` aS# 3 bS#  c# fm h{dev i"#ino j#  k # l>#len m-# 6 pt  q#  r# + s# % t#  uo#  w# I x# K  #  t #  >#$ m >#( ; S#,  S#0 ; S#4  #8 P #< o #@  #D  >#H  >#L  >#P  #T C 8#X  >#\  #` h #d  #h  #l  #p h >#t  #x ] #|  # h # Z # m # 3 #  z #  #fd ># g 8#  l# ' l# = 0# 8 0#  ># #  ¡ #! ò #)  #i  #m  #m(          g{  {E  # ^ # j#  0# !0# "E # % => W d i> Uܚ TK 60> | 5>70\i80oc9|]   !uri "0#u #0]$> %req } 0&i>cerr>' l10l20l30ap ' &Q0&uR & S>(' & p )l10l20l30)l10l20' *u *i ' *u *i K  ! k  +>|,req u -p 0J.> (n*Z *O /H0e 1p B2Нl1Q0l2Q0l3Q0l4Q0l5Q03apR 2Ȟ؞&%&%4I5# 5$ qX3l1<03l2=03l3>0043l1r0z3l2r03l3r0:. * * * /6 1 1 0 4H0 0 0 1 {7V *u *i 8V 4D8*u *i /0% 11 0= 4HK0 0 /h1O e1[ /1f 1q -1| 9  :R|xWQ^Q Qj( S0_ oldT } -newT -U0 eU0 4F#n%#n%g] g W | l    9'%;;;{; >; ;2 < ><  'S x00_int+Z&8h00I7(v >7CR dM1 - ># # .# o# # # # # D# #$ #(  #, " #0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6&#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P,#l Aq    # b# >#  &  < 'BK3 4# b 5# 6# g 7# 8# 9# :#  +  A  S =  ! h  | 4    l  \  )$ +F , . /- 2 3 : ;g <D n P       u 7# & 7#s  <V U>i c> D  %   >qJ > \`  t`Gb 5>x U4>. i 4x J 6> pid7 ! D>5 "SV#8$ S %Pt"Tz&Яد'*'6"DX#'U! n "q(|#H$ T`      ( 1>( 2>))){)x * >%) ե)8 0) ) ) ) )x *1 !>%*w ">%*I #>&*9 $>&*W P* &>&*) >* %P) (< 4S d00_int+Z&8h9o5;SI7(v7=27>KXM  - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6+#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P1#l A q  # b# >#+ A 'G\_}P "^Lj% c}x   6 w0#uCQ,}=W|K ! IW#NZB_@][NPHCGI  ` aS# 3bS# c#[f[ mhdevi#inoj# k# l>#lenm# 6p q# r# + s# %tL# u # wB# Ix## K # # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# # #fd># g# # '# =0# 80# >#  #  #! - #) > #i N #m  N #m  - > N g  @$] req? PT  $  inpA$ bufB max>Tix` cEs  > س E req΄  0 ;>  ~>سĵ req}  msg}A< c   inpA\ >U L>ĵĶ- reqK msgKAcM  MinpNA2 P>U $>Ķdft req# msg#A! %0"""{S "l / S d 00_int+Z&8h9o5;SI7(v>7 =27>KXM! - ># # .# o# # # # # D# #$ #(  #, "#0 $%#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2+#G 6;#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h PA#l A q  # b%# >#  !; Q' W \_}P "^Lj%c}x   6 w0#uCQ,}=W|K ! IW9NZX_@]qNPHCGI  ` aS# 3bS# c# qfq mh devi#inoj# k# l>#lenm# 6p q# r# + s# %tb# u# wX# Ix9# K #  # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3#  #  #fd># g# # '# =0# 80# ># ! # 2 #! C #) T #i d #m  d #m  ! 2 C T d g    (d8 keyQQ 00(n 0 0' 8|F i>>|hew reqw keyQQ>p 0U j  > reqw i> wQ!ok> "ok> "ok> "ok>  "ok>  "ok> # "ok> 4 "ok> E "ok> V "ok> g "ok> x "ok> "ok> "ok>!"ok(>#b > $req=w %b=\"p?"q?"r?&T@>'6>h1_(reqw ]& >) X* >{+n ,i>-}  . /0 + 0 + 0 + 0J +x 0( +8@ 0 + 0 + 0 1@4 2 30 +лػG 0 +Z 0 +\dm 0 + 09 +ܼ 0[ + 0l 30} 1X,c"l0&?*Z*3$d*v >t/p)bw_{4 x. . /0 2 0 2 oP qkeyp:pc5f .i/>5fA #\&6%6%6{%6 >6>68 06 66G68 7 8 $a&8 !> &7 "0.  Sp v00_int+Z&8h9o5;SI7(v7=27>KXM  - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6+#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P1#l A q  # b# >#+ A '\_}P "^Lj%c}x   6 w0#uCQ,}=W|K ! IWNZ7_@]PNPHCGI  ` aS# 3bS# c#PfP mhdevi#inoj# k# l>#lenm# 6p q# r# + s# %tA# u# w7# Ix# K # # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# # #fd># g# # '# =0# 80# >#  #  #! " #) 3 #i C #m  C #m  " 3 C g 4> req3 buf5c6Y lenZ>}[\c2 h0I {"K S 00_int+Z&8h00I7(v%SCR1- ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P #l Aq  # b# >#    '!1`MV  ;M K3 4# b 5# 6# g 7# 8# 9# :# ,6  -# P .#  /# # 06#  a t b# : c6#  d># S e># \ f6#   T * "H., 1  D  D'  | 6 H# Z H#Y Z# [# \# V]# >v`|%%__s>%%i__s>>%%__s>>>%scBx] v1w#v2w6twI]`v1\v2otlv1kv2ktkhlv1 v2t2blP2v1aov2ata)]vv1(v2(t(.0 @ v1-9v2-Lt-_ f0@ W buf1}!p1r22c22!len3>"8m  @@@#%P@$P$D$8%h&\'(  QQQ(%(Q$P$D$8)(&\'|/  QQQ(%|Q$P$D$8)|&\*m+0  v1нv2н9tлW,{ҳ u,ӽ-i>+ & v1)v2Gte, & ,-i>+ ~ v1+v2It}* m v1v2t .+!i>m/ 4 c~!p |v f@ bufcpv >0$0&? pv (14 2c@ Y3#  \ $1 %4; v5G 55Q S5[ q34 $%&#| 8$ $ %X5 "x !he 2j ~" rlLSTcM>* m< c     6~h6i6ij &6k>6l>$&6m&777{7 >8ADQ8]@(Q8<BTQ8-D>XQ88 0$Q8 Q8  `Q8 #4Q8 !Q8"P8 $P8* Q82+P8,HQ8G-Q8.\Q88 /LQ8x 6,Q80Q82 Q8 7$8l9>&8;>0Q8t<0Q8I=0Q8(0Q9 >9) >8%>PQ8&P8'@Q8 40 8 8Q | (8{(CSV ,00_int+Z&8hI7(v-i ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P#l Aq  # b# >#p  i  'g/,.,a00Zb00_1<i7Lj7LR E< P,{ Sx l+hdQdWSB ,,00_int+Z&8h9o500;Sz00I7(v777=27>KXMZ Z# Sj  C z  {# |7#  1 -y  >#   # .  # o  #  #   #   #   # D  #  #$   #(  #,  "#0  $#4 V &>#8 T *>#<  ,#@  0L#D  1Z#F  2#G 6#H  ?#L 9 H#T @ I#X G J#\ N K#` U L%#d  N>#h  P#lA q   # b #  >#  y  '  > z $F } )# + *>#( p +j#, V H dF =X %\  &# 9 'L#  )#  -#  .#  /# , 0#  1# @ 2L#( \ 4#, R 8#0 m ;#4 # Fu#8 Gu#@ J Hu#H  US#P  VS#Ti    #  #  L#  !E#  "#  DIR\_}P "3^Lj%c}x   6 w0#uCQ,}=W|K ! IWNZ_@]NPHCGI  ` aS# 3bS# c#f mh{devi"#inoj# k # l>#lenm-# 6pt q3# r# + s# %t# u# w# Ix# K  # t # >#$ m>#( ;S#, S#0 ;S#4  #8 P #< o #@  #D >#H >#L >#P  #T C8#X >#\  #` h #d  #h  #l   #p h>#t  #x ] #|  # h # Z # m # 3 # z #  #fd># g8# # '# =0# 80# >#  # ¡ #! ò #)  #i  #m   #m(          g{ {<> \> ah> reqg g j mk>l8t       >M req  M S Y >a  >0 _ >_ >\e E >,m!req " # _$m>%&l10&l20'   ( `4 ( )*@ ܿ+L ,X O- yU  . 8   )` , , , #, W, /X`001X`+2 +> % 00) + +" 1<, ' (  ><c!req $;>5 $ cS 203S4>< 4req3 5m5>q!5v 5>"66a57cs"7 p  %8 $|0"8r}t #%X r6 ~9len0;#5  #:l205D #;!% 6@ _:lenA00?env V>!>}S t00_int+Z&8h00I7(v- ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P#l Aq  # b# >#    'K3i 4# b 5# 6# g 7# 8# 9# :# y ` -key.# /# 0#y*3y0str0a0,X=$ +\$_+>z$i->W.U82TFXh] hx]nM0x$strL$ T $  %!w08%7;%" 8N% m%#key%%uTXd$"%$"%0%6@% &iA>'B&C>T'D>%&C&( n&(&key&(&)uT'*%%+ )>',t!H'J('u0(0T- / 0' JY(!RHw(($'u('0(%}t(|)|8)'~0V),ti    0 ..5 0&.6 &///{/>/GSL tPX00_int+Z&8hI7(v-i ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P#l Aq  # b# >#p  i  ' E <2L340Lt3 # 3# C  ]]  t E N# ڹ  # } C#  Y# * # {>t]szi)p|>tLStnT|)isS) S)lenS0)gf0bufgWQ4>P)3>*ip33*D30Q*;td $LL MS! P[00_int+Z&8h9o5;SI7(v7=27>KXM  - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6+#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P1#l A q  # b# >#+ A 'G\_}P "^Lj% c}x   6 w0#uCQ,}=W|K ! IW#NZB_@][NPHCGI  ` aS# 3bS# c#[f[ mhdevi#inoj# k# l>#lenm# 6p q# r# + s# %tL# u # wB# Ix## K # # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# # #fd># g# # '# =0# 80# >#  #  #! - #) > #i N #m  N #m  - > N g Po* A** req *>ZT (*' | A +>>+A\+Az+>W,(+ | A+>+A+A,>W;, >UZ, reqξ y, A,!, req ,) -j *>(- Y 0>Q-z uz j {]< >tQ!>!;St $!00_int+Z&8h9o500;Sz00I7(v777=27>KXza  {# |7#-! >#  # . # o #  #  #  #  # D #  #$  #(   #, "_#0 $e#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2k#G 6{#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P#l Aq _ _# be# >#(a { !  '=X% &# 9'L# )# -# .# /# ,0# 1# @2L#( \4#, R8#0 m;#4 # F8#8 G8#@ JH8#H US#P VS#Tm hdev i"#ino j#  k # l>#len m-#Pzlz- ey-%l$-m$>-s$ .m&+.i'>I. '>Y v T>r.0 A^>pv b>.]>'>'>'  F"'ee{e >4 bSI $ $00_int+Z&8h9o5;SI7(v7=27>KXM  - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6+#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P1#l A q  # b# >#+ A '\_}P "^Lj%c}x   6 w0#uCQ,}=W|K ! IWNZ7_@]PNPHCGI  ` aS# 3bS# c#PfP mhdevi#inoj# k# l>#lenm# 6p q# r# + s# %tA# u# w7# Ix# K # # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# # #fd># g# # '# =0# 80# >#  #  #! " #) 3 #i C #m  C #m  " 3 C g  >$ . req  ., >.; >*/  >H/2\H  >q/!I > /4 req /;>/ %V>t!0 req L0;>j0 %00 :'>t 1 req& ,1(>J1,)01x ce bufe1!!!{"0c +Sl &00_int+Z&8h9o5;SI7(v7=27>KXM77D# K## 3 N  N  - ># # .# o# # # # # D# #$ #(  #, "L#0 $R#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2X#G 6h#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h Pn#lA q L L# bR# >#N h  ~ ' \_}P  "^Lj %;c}x   6 w 06#uCQ,}=W|K ! I WUN Zt_@ ]NPHCGI  ` aS# 3 bS#  c# f m h(dev i#ino j#  k# l>#len m# 6 p!  q#  r6# + s# % t~#  u;#  wt# I xU# K #  ! #  >#$ m >#( ; S#,  S#0 ; S#4  #8 P #< o #@  #D  >#H  >#L  >#P  #T C #X  >#\  #` h #d  #h  #l  #p h >#t  #x ] #|  # h # Z # m # 3 #  ' #  - #fd ># g #  ># ' ># = 0# 8 0#  ># = #  N #! _ #)  p #i  ʀ #m  ˀ #m =  N  _  p  g(  (u t reqt     req ^%1H req$ 2 &-    '  MD#2 reqL B2  N    $( O   D]  P v2 ]  P Q R R!P ?! ?!t ?  3  3  > SA dn)00_int+Z&8h9o5;SI7(v7=27>KXM  - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6+#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P1#l A q  # b# >#+ A 'G\_}P "^Lj% c}x   6 w0#uCQ,}=W|K ! IW#NZB_@][NPHCGI  ` aS# 3bS# c#[f[ mhdevi#inoj# k# l>#lenm# 6p q# r# + s# %tL# u # wB# Ix## K # # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# # #fd># g# # '# =0# 80# >#  #  #! - #) > #i N #m  N #m  - > N g Kw rJ4" req! r#bob&m T qQ reqP    m [, reqZ  ZS3ZS \r]w ,2v  P 2!P 2"_ h )m #_ ,D] m P$dx>D 3" %reqw $3& zX3'rzv3( )_  ! )_  $I0 3[ *r1T+G y$>44 %req B4%strA`4XA! ,>~4, >4, S4,3S4-}# ~.c,>5,->5/  kf  )w SA !8 H5!P  )_ h ) 0 @lc  1w @lSA 2@l 5!  )_ ) 3 n   !  5 " 6> 4#C4d967 2HPrEG 7 5?666{6 > S dT|,00_int+Z&8h9o5;SI7(v7=27>KXM  - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6+#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P1#l A q  # b# >#+ A '\_}P "^Lj%c}x   6 w0#uCQ,}=W|K ! IWNZ7_@]PNPHCGI  ` aS# 3bS# c#PfP mhdevi#inoj# k# l>#lenm# 6p q# r# + s# %tA# u# w7# Ix# K # # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# # #fd># g# # '# =0# 80# >#  #  #! " #) 3 #i C #m  C #m  " 3 C g q>dX6 reqp 6;r>6 s06c6I 7>6 req6 78>87,90w790(>T7 req' 7)> 8"*8 *uc+E8   >8Hm>t9h09   {  >!>!I 0:L!S TP#/00_int+Z&8h9o5;SI7(v70=27>KXM77D. K.# > N Y  - ># # .# o# # # # # D# #$ #(  #, "W#0 $]#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2c#G 6s#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h Py#lA q W W# b]# ># Y s   ' E ! < 2L3 40 L t   #  #   ]]   : E #    # } #  # * #\_}P "^Lj%<c}x   6 w07#uCQ,}=W|K ! IWVNZu_@]NPHCGI  ` aS# 3bS# c#f mh)devi#inoj# k# l>#lenm# 6p" q# r7# + s# %t# u<# wu# IxV# K # " # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# ( # . #fd># g# I# 'I# =0# 80# ># > # O #! ` #) q #i ʁ #m  ˁ #m >  O  `  q  g) ) л u7# & 7#p T9 ptr  9  T > :U req ":c@::V> : req ;c6HW>2;) reqV ];3X{; X;   p10g<p20<!+t<y req =">B=#t  0!~/t,v= req. =i0>=#$buf } %X6 ,!> &req7 T'R @> (Q>l>)fdS>>*<T:L*U:*V0}(+W >)lenX>,  P#? ">=? >[?u @   *d'0-]-]-{]->.% xQ-P - -t ->->->/ a/I 0/9 >/ >/0/ //.#0?.$0?=#S P#05500_int+Z&8h9o5;SI7(v7=27>KXM  - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6+#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P1#l A q  # b# >#+ A 'G\_}P "^Lj% c}x   6 w0#uCQ,}=W|K ! IW#NZB_@][NPHCGI  ` aS# 3bS# c#[f[ mhdevi#inoj# k# l>#lenm# 6p q# r# + s# %tL# u # wB# Ix## K # # >#$ m>#( ;S#, S#0 ;S#4 #8 P#< o#@ #D >#H >#L >#P #T C#X >#\ #` h#d #h #l  #p h>#t #x ]#| # h# Z# m# 3# # #fd># g# # '# =0# 80# >#  #  #! - #) > #i N #m  N #m  - > N g A} ver  req tT _ P##] q .A##LA req kAmsg`} ##]  Ato#X$AA reqn A]QX$$Aj reqP AgB$4%,B reqA KBa4%%iB req` Bb}dc%P&B/ reqb B!bAB"_ %%g# 9P&'C req8 C$:$@0?$A?%'(>C req$ ]C"_ '')# (({C req C"_ @(D(# (4)CS req C"_ ((# 4) *C req D$$0? *+2D req ^D$ ~%len0? "++|D@ req D"_ 4+8+# Q+P,D req D"_ ++# pP,-D reqo E"_ t,x,t# W--3E reqV RE!;VApE"_ ,-0-[# D-x.ET reqC E"_ ..H# |x.x/E req E urlAF!A&F"_ ..# x/X0DF req cF urlAF"_ //# X00FYreq̞ F&_ t0x0G# msgέL=I00FreqH FlmJmT001Greq/ 8G1UF1d2VG  req uG"_ 11# !7d22GF req6 G'_ :# b2x3Greq G(_ 33# 5zx33 Hreqy ,Hmsg{34JHreqߞ iH)_ # msg4*m>405Hmreq H+rH(} 55# } . %     D d ,,,-l>->_ L&S 05;900_int+Z&8h0I7(v >G77 dM # S  - ># # .# o# # # # # D# #$ #(  #, "#0 $!#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2'#G 67#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P=#lA q  # b!# ># 7  M 'S c >s z $ } )X# + *>#( p +#, s H d   u 7# & 7# K > ".= #>T $  %  @^  A# , B# G  H>#  I>#  J.# O  P# , Q#  R.# W  X# , Y#  Z>#  [#  \# a*  b# gO ^ h7# 0 i>#t ;X < C9) K^_rt S ] ce j* >   4  5>#  6># f 8># n kO# 3 l$6 "@:>:$  $# ,# /># 2#05L5]>PQL5`5]>P`5t5]>Pt55]+>P55H5t6Hv>tpidTAt66!I%67@I >_I77rIx788I888I >I]88I0 > Jb8(:JXsacF~1(:;KJsa2F~!!!!!{!! ! ! " M"1 >"w >"I >"9 >"W " >" #envQ$>Qk E(S ;L<00_int+Z&8hI7(v7M / - ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P#l A q  # b# >#  ' 1f`MV  ;M tm,  P!># > ># !># 7!># ># ># ># T >#  ># 7#$ #(#dbgO ># #} >o E .;`<]K -wJ /\c/Q>`<@=]?!JW!>@=>!KBuri@Kh ^Kc|KdQ (!K>>Li0$Lp\!| O"M>?7L& LVLtoLtLlenL>L#0kOS\cP>LEs>?@LdstLsrc M >)M  >GM  >pMval!>M$len">x">^y">%N"g @$AoN$p#"5 $A`ANsN >`A8BNQrNcO !a1OlenaOO!Y>8BhBmOfdX>O Z>O!L>hBBOfdK>O M>O #>BC PS"a,Pl!"JP_"0hPfd%>P%H@$len20!$?y >C DPsP >P P&OCC'b" DtEQfoo1Qi>eQ$p" tE0GQ\ bufQsQt\ QpRa0'Rfx0G|GfR strwR( y)XG\G( >*\ >. + \ +0!,?!. ( $day>(>(!>(I!>(>> R>|GIR Q RQS S\ BS( Tf nU>`S- `W' ' #. / 0 S0 S0 T0 7T0! WT1t!ILwTl 2t\ T2pT2a0T3 >Ubufl O|  +  ( d!! X # !  $ ?!D  444{4>4- >5 5 -!+S! L0NA00+intZ&8aI_(oZ  -y Z# # .# o# # # # # D# #$ #(  #, "#0 $#4 V&Z#8 T*Z#< ,z#@ 0>#D 1L#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d NZ#h P#l A q  # b# Z#   y' 7<2>340 +K  A  S = > t K# #  !G h  | 4    l  \  )$ +F , . /- 2 3 : ;g <D n P      ]]   x E R#  ڽ  K# } G#  ]# * #   a t b# : c#  dZ# S eZ# \ f#!FZLPM$UEOUpGfdHZUDHZsaIxhheJULLR> !,ZPMMUE+U!-lpid.Z!eZM0N]dVfdfZ ,S! 0NxS"C00_int+Z&8h9o5;SI7(v7"7=27>KXM"F5  G# "H#77 DW KW# 5g N@  -B  >#  # . # o # #  #  #  # D # #$  #( #,  "#0  $#4 V &>#8 T *>#<  ,#@  0L#D  1Z#F  2#G 6#H  ?#L 9 H#T @ I#X G J#\ N K#` U L%#d  N>#h  P#lA q   # b #  >#I  B  ' \_}P  "^Lj %oc}x   6 w 0j#uCQ,}=W|K ! I WN Z_@ ]NPHCGI ` aS# 3 bS#  c# fm h\dev i#ino j#  k# l>#len m# 6 pU  q#  rj# + s# % t#  uo#  w# I x# K #  U #  >#$ m >#( ; S#,  S#0 ; S#4  #8 P #< o #@  #D  >#H  >#L  >#P  #T C #X  >#\  #` h #d  #h  #l  #p h >#t  #x ] #|  # h # Z # m # 3 #  [ #  a #fd ># g #  r# ' r# = 0# 8 0#  ># q #  ‚ #! Ó #)  Ĥ #i  ʴ #m  ˴ #m  q     g\  \! u  ! !/0NxS1V J .>\VD __i00"0 `NtNh __i10"1  '"Z T ~ @ V!  tW" g # $$${$P $ %*g0R%+gR%,>P& >&t 0&I 0&1 >&w >&I >&9 >& >& 0& & 0" ^.SU" xSPXE00+intZ&8a9h5z;EI_(o1- Z# # .# o# # # # # D# #$ #(  #, "#0 $#4 V&Z#8 T*Z#< ,#@ 0>#D 1L#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d NZ#h P#l Aq  # b# Z#    '=27>KXM L  \ \_}P "^Lj%c}x   6 w0#uCQ,}=W|K ! IW3NZR_@]kNPHCGI ` aE# 3bE# c#kfkmhdevi#inoj# k# lZ#lenm&# 6p q# r# + s# %t\# u# wR# Ix3# K # # Z#$ mZ#( ;E#, E#0 ;E#4 #8 P#< o#@ #D Z#H Z#L Z#P #T C1#X Z#\ #` h#d #h #l  #p hZ#t #x ]#| # h# Z# m# 3#  #  #fdZ# g1# <# '<# =0# 80# Z#  # , #! = #) N #i ^ #m  ^ #m   ,  =  N  ^ g J"3 4# \"6# 3"7Z# 8 # o ";o "IZ dirHN0O0cP7 xSS].  W   n"SSWy iZy USSy T "ZSTWL 'X "EX \"L cX!"L}"pwdX# %%$TT- %%%%&%%%%'x"(ZThWX (req' X)u)y X%*Zpwd+"- ~)\".L Y# )"@Z\YVV%|%%|%;",<Pd - *"vhWWY^ wZ+curxy T,e"`WPXY _Y | _Y"ay "olday ZWWf%f% y .!"= ,P---{-0S" PXXH00_int+Z&8hI7(v-i ># # .# o# # # # # D# #$ #(  #, "#0 $#4 V&>#8 T*>#< ,#@ 0L#D 1Z#F 2#G 6#H ?#L 9H#T @I#X GJ#\ NK#` UL%#d N>#h P#l Aq  # b# >#p  i  '"PXX(Z{8 01I /home/usb10132/ct1/bin/targets/arm-vfp-linux-gnu/build/build-libc/csu/crtn.S/home/usb10132/ct1/bin/targets/src/glibc-2.7/csuGNU AS 2.19.50.0.1U%% : ; I$ > $ > $ >   I : ;  : ; I8 I !I/ : ;I8 : ; &I : ; ( (  : ; I8  : ; !I/.? : ;' I : ;I.? : ;' @4: ;I4: ;I  .: ; ' I@: ; I4: ; I4: ; I4I4  .: ; ' I !: ; I": ; I#4: ; I$.: ;' I %: ;I&4: ;I' ( ) *1+.? : ; ' I@,: ; I-4: ; I.1UX Y / U0411412 34: ;I4 U54: ;I641 71UX Y81X Y94: ; I :.? : ; ' @;4: ; I? < <4: ;I? < % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I : ; (  : ; .: ; ' : ; I4: ; I 1.: ;' 4: ;I.: ; ' I 4: ; I4I4   .? : ; ' I@: ; I4: ; I 4: ; I! U"1UX Y # U$41%1X Y & '41(4: ; I )4: ; I? < *4: ; I?  % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8 &I : ; ( (  : ; I8  : ; !I/.? : ; ' @ : ; I .? : ;' I@: ;I4: ;I 4: ;I.? : ; ' I@: ; I4: ; I U4: ; I 4: ; I !4: ; I"4: ; I? < % : ; I$ > $ > I!I/ $ >   I  : ;  : ;I8 : ; : ; I8 &I : ; ( (  : ; I8  : ; !I/.: ; ' I@: ; I: ; I4: ; I.? : ; ' @4: ; I.? : ; ' I@4: ; I4: ; I .: ; ' I : ; I ! "4: ;I#.: ;' $: ;I%: ;I&4: ;I'.? : ;' I@(: ;I)4: ;I *4: ;I+ ,4: ;I-1UX Y.1/ U0411 U2413 41UX Y54I4  64: ; I? < 74: ;I? < 84: ; I?  % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8  : ; ( (  : ; I8  : ; !I/.? : ; ' I@: ; I4: ; I4: ; I  U4: ; I U4: ;I4: ; I? < % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I : ; (  : ; !I/' I.? : ;' I : ;I: ;I4: ;I.: ;' 4: ;I.: ;' @ : ;I.: ; ' @ : ; I.: ;' @ 4: ;I !4: ;I" U#1UX Y$1% U&41' (1X Y) *4I4  +.: ; ' @,4: ; I-4: ; I.4: ;I/.? : ;' I@0 1.? : ;' @24: ;I 31UX Y441 54164: ; I 74: ; I? < 84: ; I?  94: ;I? < % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ .? : ; ' @4: ; I4: ; I4: ; I 4: ; I &I4: ; I? < 4: ; I?  % : ; I$ > $ > $ >   I : ;  : ; I8 I !I/  : ;  : ;I8 : ; &I : ; : ; I<  : ; ( (  : ; I8 !I/.? : ;' I : ;I.: ;' I : ;I4: ;I 1  .? : ;' I@!: ;I": ;I#4: ;I $4: ;I% U&4: ;I'1X Y(1UX Y) U*41 +41,41-1X Y.1UX Y/ 041 25I3.? : ; ' I@4: ; I54: ; I64: ; I 71X Y 84: ;I94: ; I:4: ; I;4: ; I<4: ; I =4: ; I? < >4: ;I? < ?4: ;I? < % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ &I : ; I8 .: ; ' I : ; I4: ; I.: ;' I : ;I.: ;' @: ;I4: ;I 4: ;I  .? : ;' @ .: ; ' I@: ; I1UX Y 1 U 41!.? : ;' I@".: ;' I@#: ;I$4: ;I%.? : ;' @&4: ;I'4: ;I(: ; I)4: ; I* + U,4I4  -1UX Y.4: ; I /4: ; I? < % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ .? : ; ' I@ : ; I4: ; I 4: ; I .? : ; ' I@: ; I4: ; I4: ; I 4: ; I? < % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8 &I : ; ( (  : ; I8  : ; !I/.? : ; ' @: ; I: ; I4: ; I .? : ;' @: ;I4: ;I 4: ; I U4I4  4: ; I? < 4: ; I?  !4: ;I? < % : ; I$ > $ > $ >   I : ;  : ; I8 : ;I8 : ; I !I/  : ; I8 .? : ; ' @: ; I.? : ; ' I@: ; I4: ; I4: ; I  U4: ; I U4: ; I 4: ; I? < % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8  : ; ( (  : ; I8  : ; !I/.? : ;' I@: ;I4: ;I : ; U4: ;I.? : ; ' I@: ; I4: ; I4: ; I  : ; 4: ; I 4: ; I!4: ; I? < "4: ;I? < % : ; I$ > $ > $ >   I : ;  : ; I8 I !I/  : ;  : ;I8 : ;  : ; ( (  : ; I8  : ; !I/.? : ; ' : ; I: ; I.? : ; ' @: ; I1RUX Y 11RUX Y .1@ 1 1 4: ; I? < !4: ; I?  % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8 &I : ; ( (  : ; I8  : ; !I/.? : ; ' : ; I4: ; I 1.: ; ' 41: ; I4: ; I.1@1 41! U"1RUX Y #.1@ $.? : ; ' I@%: ; I&4: ; I'4: ; I( U)1UX Y *4: ; I +4I4  ,4: ;I-4: ;I .4: ;I/1UX Y01X Y11X Y 2 31UX Y4.? : ; ' @54: ; I 64: ; I? < % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8  : ; ( (  : ; I8  : ; !I/.? : ;' I@: ;I4: ;I U4: ;I4: ;I.? : ; ' I@: ; I4: ; I4: ; I4: ; I U 4: ; I? < !4: ;I? < % : ; I$ > $ > $ >   I : ;  : ; I8 I !I/  : ;  : ;I8 : ; &I : ; ( (  : ; I8  : ; !I/.? : ;' @4: ;I4: ;I .? : ;' I@: ;I4: ;I U4: ;I : ; U 4: ;I!.: ;' @": ;I# $4: ;I %.? : ; ' I@&4: ; I '.? : ; ' @(: ; I)4: ; I*4: ; I +4: ; I,4I4  -4: ; I? < .4: ; I?  /4: ;I? < % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8 &I : ; ( (  : ; I8  : ; !I/.? : ; ' I : ; I.? : ; ' 4 .1@ 1.? : ; ' @: ; I4: ; I 4: ; I .? : ;' @ : ;I!: ;I"1X Y#1$4: ;I %4: ;I &1X Y '1UX Y(1X Y )1UX Y *.? : ; ' I@+4: ; I,4: ; I? < -4: ;I? < % : ; I$ > $ > $ >   I : ;  : ; I8 I !I/  : ;  : ;I8 : ; &I' I : ;  : ; I : ;  : ; I' .? : ; ' @ : ; I .? : ;' @ : ;I .? : ;' @.? : ; ' @4: ; I 4: ; I .? : ; ' @ : ; I!4: ; I? < "4: ;I? < #4: ; I?  $4: ; I?  % : ; I$ > $ > $ >   II !I/  : ;  : ;I8 : ; : ; I8 &I : ; (  : ; !I/ : ;.? : ;' I : ;I.? : ; ' @ : ; I4: ; I 4: ; I .? : ; ' I@ .? : ;' I@: ;I: ;I4: ;I4: ;I 4: ;I!4: ;I ".? : ;' @# U$4: ;I% U&1X Y'1(4: ;I) *.: ; ' I +: ; I,4: ; I-1UX Y.41 /410411.? : ; ' I@24: ; I34: ; I44: ; I? < 54: ;I? < % : ; I$ > $ > I!I/ $ >   I  : ;  : ;I8 : ; : ; I8 &I : ; (  : ; .? : ; ' I@: ; I4: ; I4: ; I4: ; I4: ; I  4: ; I .? : ; ' I@ 4: ; I? < % : ; I$ > $ > $ >   I : ;  : ; I8  : ;  I !I/ : ;I8 : ;  : ; ( (  : ; I8  : ; !I/.: ; ' 4: ; I .? : ; ' @: ; I U4: ; I 4: ; I 1UX Y  U 41!41"4I4  #&I$4: ; I? < %4: ; I?  &4: ;I? < % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/  : ; ( (  : ; I8  : ; !I/.? : ; ' I : ; I4: ; I4: ; I.1@ 141.? : ;' @4: ;I4: ;I  .? : ; ' I@ : ; I!4: ; I "4: ; I# U$ %4: ;I& U'.? : ;' I@(: ;I)4: ;I*.? : ; @+4: ; I ,.? : ; ' @-4: ; I? < % : ; I$ > $ > $ >   I : ;  : ;I8 : ; : ; I8 I !I/ .? : ; ' @4: ; I? < U%c /home/usb10132/ct1/bin/targets/arm-vfp-linux-gnu/build/build-libc/csucrti.S /0//////L$/dY9T /opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/sys/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../lib/gcc/arm-vfp-linux-gnu/4.3.2/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/bits/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/includealias.cstat.hstddef.htypes.htypes.htime.hstdio.hlibio.hstat.hglobals.hdefines.hJ3kg/g//xJ JrJJzJ3Ml-/-wJ tJtz.4z.4z.4.N~Jh1Ld05KMJ fj`.Kg/$.fj@gmA`.J- IgKOz.0j,0,005////e/K//0(K-K. k}J/x %f +MKLLH2NgKI/d0H0/KKEJKK-K/IgKI2,L0Q////e/KK-/  $F6 .v.6KJ^JJ* .K-K3JJK-K/~..P`.}JK[fKJ~L,/gk26h-/e0-/>PK}KK-K2M,0fKK-K2gPz.4KKnfK t.2Rx.O#K-KOe.J"fLfN+1-,0 .,LxJ .a/~KK~fg J0 /,//LKR/-//KJHLff f}f/-.S.-.f KKrJsfgf KKeJKKKkfK-///KnfK~fpggKK~JK .xJ+ .KNsJKJ }`/e/-/g-/1I/j)3)k/,x.0h+1.F22LH0G0gI/F/M+11 fsJ fsJ .s .g*K15j)Rz./IJ-/.e /opt/nxp/gcc-4.3.2-glibc-2.7/bin/../lib/gcc/arm-vfp-linux-gnu/4.3.2/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/bits/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/sys/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/includecgi_header.cstddef.htypes.htypes.htime.hlibio.hstdio.hglobals.h3*21,E .g JN*.nxJ40x.6,.J...f+1Q/-/-/5L,0 K1+/I0-0n.K2*-K~fgLJgM-/0L,0~g-K/K$L gfj-/0M+1vMhL giKA/-f/Kp$ /opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/bits/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../lib/gcc/arm-vfp-linux-gnu/4.3.2/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/sys/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/includeconfig.cstring2.hstddef.htypes.htypes.hstdio.hlibio.hpwd.hgrp.hnetdb.hglobals.hresource.hdefines.hctype.h~..2/*f-./j/b/h/=-./-/-///g-Af/K25y.5/ J0Jz.g/Jv,zf J0,LbgaJ.J,zfM,0L=I/J,{KeJg/s2*2*2NI .ghsJKQq//Q 3)3)3NI .ghsJKQq//& /-/-/NKg/K-/1g5y.u./ Jg1+y. 1+1+1+12K/glJ/ Jg ,0,0OE3wJ/i0,05y./G .K@J!fTJ ./-/ofB-/K/gY-/1+/K/ //00/0/0/-I//#5y.K//////Kg/-/W-/ghL-/Kl/L-/K\P+/0,-1/ggggggggghJO,0,0/ggggggggwJ ./iI/-/1I/-/1I/-/1I/-/0/e1,1e/1I/-/0/e/1e/1e//Cl /opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../lib/gcc/arm-vfp-linux-gnu/4.3.2/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/bitsutil.cstdlib.hstddef.htypes.htime.hlibio.hstdio.hdefines.hglobals.hctype.h;--K64q.g-/0K-0-0 JK.02l.LJPz.4z.+.[./JPJ/[J%.[.)JhXJ-/I/".fJ/LL-/Kf .0,L,00/-KNiI/I/-"///t. .///s./.KBf.3)O3,0d.p.KgQs.h,0N,1,0M-/0,0)01Es./h,J1OK-T/-/IheN.J1h.نG1) .wJ .w..w 1+1/-/2h,k.1+1/-/2h,O.2*2*Nb21K-/4KL,01L/܃L/q  JcJ/fG .22}JMK 2NI/ fK-/5 yJ fq.MRg/q.q../h,q./hK3) .}<3).O/ f/0,0,-/-11,4z.I11H-/0gg//,5L-1,-/1[J 1+1h-/-1~ fNJ...JJJ2J"C#/& .w./gK*///5z.45LLLhLfN*2hhzfK/~"y.5gKQy.-/.y..z.00/w.//I100//gM-1,0,-/-11,I11,-/0g//,3LyQy.m/0-3*/,//0S.O2+/,//5)00s.. /opt/nxp/gcc-4.3.2-glibc-2.7/bin/../lib/gcc/arm-vfp-linux-gnu/4.3.2/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/bits/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/netinetsublog.cstddef.htypes.hlibio.hstdio.hstdint.hsockaddr.hsocket.hin.hnetdb.hL3).3/LKLK-//POcwVJ3/ JK2*3rJKjNxK-hMO ,5y, .wd /opt/nxp/gcc-4.3.2-glibc-2.7/bin/../lib/gcc/arm-vfp-linux-gnu/4.3.2/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/bits/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/sys/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/includeselect.cstddef.htypes.htypes.htime.htime.hselect.hstdio.hlibio.hglobals.h0N.-/aJ2Q+M+11M+M+1,-/0PD>D ?,D@lD$A<D `AD 8B0DhB0DBLCtD  DTDtEDH0GLD$|GpD$HT IH | LDHPMD D M4 | $0NHD$ L8 | (xS(SdD$(SDH (THH(hWhD(WD | PXtD __u_quad_t/home/zhongrw/dev_develop/platform/lpc3250/boa-0.94.14rc21/srcst_ctimst_blksizepath_translatedst_blocksRESPONSE_CODEdocument_root_IO_save_endclient_stream__gid_t__func__st_mtim_IO_write_baseSCRIPTALIAS_lockuse_count_IO_save_baseCGI_PARSE_chain_cur_columnalias_hashtablefakelen__dev_tR_BAD_REQUESTR_METHOD_NA__pathrealnametime_last_IO_markerR_NOT_FOUND__s2_lenHTTP_VERSION__blksize_t_IO_FILEst_uidM_POSTR_GONEunsigned charif_modified_sincest_rdevM_GETCGI_DONEurilenfake_lenHTTP09buffer_endR_LENGTH_REQUIREDauthorization_IO_lock_tHTTP11GNU C 4.3.2M_DELETEheader_user_agent__mode_t_IO_read_ptrheader_ifrangedata_memcgi_env_indexstdintemp_next__s1_len_markersIOSHUFFLEkeepaliveR_PRECONDITION_FAILEDmmap_entry_varpath_infoPIPE_READmethodst_gidstopkacountCGI_TYPEcgi_status_flags2st_sizedump_alias_IO_read_baseR_MOVED_TEMP_unused2__quad_tfind_aliasheader_hostget_alias_hash_valueR_PARTIAL_CONTENTBODY_WRITE__unused4__unused5req_urip_old_offsetlocal_ip_addr__blkcnt_tremote_ip_addrDEAD__ino_tR_ACCEPTEDKA_INACTIVElong long intpost_data_fdalias.ccurrent1debug_levelR_PAYMENT_IO_write_endR_SERVICE_UNAVreal_lenR_205R_REQUEST_URI_TOO_LONGTIMED_OUTONE_CRR_PROXY_IO_buf_baseuri_lenR_ERRORM_HEADresponse_statusR_MOVED_PERM__pad1__pad2__pad3__pad4__pad5M_PUT_sbufquery_stringcurrentM_UNLINKTWO_CRvhost_rootHTTP_METHODR_NO_CONTENTst_nlinkuser_homedirscript_nameKA_STATUSst_devheader_refererKA_ACTIVEtimespecKA_STOPPEDfileposbuffer_startlong long unsigned intremote_port__off_tR_PROVISIONALCGI_BUFFERREQ_STATUSR_CREATEDR_REQUEST_OKinit_script_aliasREDIRECTR_303R_INVALID_RANGEparse_pos__time_tclient_stream_posvirtualhostR_MULTIPLE_IO_backup_base_shortbufBODY_READCGI_STATUS__off64_tuser_dirfilesize_IO_buf_endM_MOVER_FORBIDDENREAD_HEADERheader_linestderrshort intM_LINKtv_nsecR_BAD_VERSIONM_TRACEONE_LF_vtable_offsettranslate_urinumrangesR_UNAUTHORIZEDfakenameR_NOT_MODIFIEDR_REQUEST_TOst_mode__uid_tR_CONTINUE_IO_read_endbytes_writtenR_GATEWAY_TO_filenoHTTP10reallenmmap_entryPIPE_WRITErequest_uricgi_typeshort unsigned intstdout_IO_write_ptrRangeR_NON_ACCR_BAD_GATEWAYst_ino__statbuf__nlink_tR_NOT_IMPR_CONFLICTprevtv_secpath_lenst_atimhttp_versionserver_portIPPROTO_MTPIPPROTO_PIMIPPROTO_TPpw_gidIPPROTO_ENCAPIPPROTO_IGMPIPPROTO_AHIPPROTO_RSVPpw_shellserver_gidIPPROTO_NONESOCK_STREAMpending_requestsPID_FILEIPPROTO_PUPcurrent_timeIPPROTO_COMPSOCK_RDMIPPROTO_ICMPV6errorsIPPROTO_ESPsigterm_flagIPPROTO_FRAGMENTstart_timepw_passwdIPPROTO_UDPoptarg__retvalpw_uidboa.cIPPROTO_MAXIPPROTO_TCPsock_optserver_ipIPPROTO_IPV6__socket_typeserver_uidpw_dirIPPROTO_SCTPIPPROTO_RAWIPPROTO_IDP__pid_t__lenpw_gecosbacklogsighup_flagSOCK_PACKETsigalrm_flagparse_commandlineIPPROTO_HOPOPTSpid_fileIPPROTO_EGPpasswdbufIPPROTO_ICMPfixup_server_rootdo_forkIPPROTO_GREdrop_privspw_namecreate_server_socketSOCK_DGRAMprogramnamedevnullfdconfig_file_nameIPPROTO_ROUTINGIPPROTO_IPIPSOCK_RAWserver_sSOCK_SEQPACKETmainIPPROTO_DSTOPTSsigchld_flagIPPROTO_IPmsg_lenreq_flushbytes_to_writedestreq_write_escape_httpreq_write_escape_htmlescape_stringreset_output_bufferbuffer.creq_writeverbose_cgi_logsclear_common_envdirmakercommon_cgi_envadd_to_common_envcreate_argvkey_lensaved_errnocgi_umaskprefix_lencomplete_envuse_pipescreate_common_envserver_admincgi.cchild_pidcommon_cgi_env_countvalue_lencgi_pathserver_namecgi_log_fdhttp_prefixenv_gen_extrainit_cginewpathdefault_typeaargcoldpathaargvhowmuchcgi_header.cpnextptmpprocess_cgi_header__RLIMIT_RSS_ISgraph__RLIMIT_NLIMITSc_add_mime_types_filegr_namelookup_keywordRLIMIT_DATAmax_connections_ISspaceka_timeoutsingle_post_limit__RLIMIT_MEMLOCKc_add_auth_ISalphaobjecterror_log_nameconceal_server_identityaccess_log_namec_set_userclistsecond_ISalnumhostentread_config_files__resultcurrent_uid__RLIMIT_SIGPENDING_ISblankRLIMIT_CPU_ISpunctdefault_vhostgr_mem__rlimit_resourcecgi_log_nameka_maxgr_passwdrlim_maxconfigtemp_nameh_namegroupbuf__RLIMIT_RTPRIO__RLIMIT_NPROCRLIMIT_FSIZEc_set_groupc_set_inttempdirh_addrtypetrimaccess_allow_number__RLIMIT_LOCKSdirectory_indexendptrc_set_string__rlim_tRLIMIT_COREh_aliases__RLIM_NLIMITSh_lengthh_addr_listc_set_unitydefault_timeout__strcspn_c1__strcspn_c2__strcspn_c3c_add_mime_typedefault_charsetaccess_deny_numberccommandc_add_access__reject1__reject2__reject3extensionredirect_numberRLIMIT_ASrlim_curapply_command_IScntrl_ISxdigit_ISloweralias_numberCommandscript_numberc_add_alias_ISdigitcachedir__RLIMIT_NICEconfig.cRLIMIT_NOFILE__RLIMIT_OFILERLIMIT_STACK_ISuppergr_gidc_add_cgi_env__r0__r1__r2rlimit__rejectargsuse_localtime_ISprint__RLIMIT_MSGQUEUEescape.cspecialbuild_needs_escape__jmp_buf_tagfdstreamget_dirdirbufrequest_dirbytesd_typesystem_bufsized_nameprocess_getget_cachedir_fileerrno_savebytes_freedest_filename__dirstreamgzip_pathname__mask_was_savedfstatget.csigjmp_bufinit_get__fdescnamedirent__saved_mask__jmpbuf__jmp_bufwantindex_directorypathname_with_indexd_off__vald_reclend_inohandle_sigbus__sigset_treal_dir_mtime__s1trailerdump_mimeget_home_dirhash_findhash_structhash_show_statsdump_passwdget_mime_type_hash_struct_boa_hashget_mime_hash_valuehash.cfnv1a_hashhash_clearget_homedir_hash_valuehash_insertmime_hashtablepasswd_hashtabletotalserver_sockaddrsin_familynet_portsin_addrsa_family_tsin_zerouint32_tuint16_ts_addrip.cbind_serverin_addr_tnewlenascii_sockaddrsin_port__bsxin_port_tsa_familysa_datasockaddr_inlog_error_mesgboa_perrorlog_error_timeerror_loglog_error_docopen_logslog_errormessageaccess_logfunclog_accesslog_error_mesg_fatalmretmmap_listrelease_mmapmmap_list_entries_usedmmap_cache.cmmap_list_total_requestsmmap_list_hash_bouncesfind_mmaprestartwritebytes_readrestartreadsendfile_offsetio_shufflewrite_from_piperetrysendfileio_shuffle_sendfilebytes_to_readread_from_pipepipe.crequest_readyblock_requestqueue.crequest_freeready_requestenqueuefd_setrequest_blockdequeueblock_read_fdset__fd_maskheadmax_fdblock_write_fdset__fds_bitsrange_addrange_poolccoderange_pool_pushrange_pool_emptyranges_resetrange.crange_pool_popinitial_strranges_fixuprange_abortstablefcoderange_parseread_headerbuf_bytes_leftread.cwrite_bodyread_bodyprocess_header_endsalocalconnbytes_to_movetotal_connectionsstop2get_request__socklen_tsanitize_requestremote_addrprocess_loglinenew_requestsockbufsizefree_requestsfree_requestprocess_requestsserver_sockremote_addrlennew_reqprocess_option_linerequest.csend_r_unauthorizedsend_r_continuesend_r_bad_requestdate_headerprint_partial_content_donerealm_namesend_r_length_requiredprint_ka_phrasecomplete_responsesend_r_not_implementedmsg2more_hdrsend_r_bad_gatewaysend_r_forbiddensend_r_partial_contentprint_http_headerssend_r_errorsend_r_no_contenthttp_ver_stringsend_r_not_modifiedprint_partial_content_continueprint_content_typeprint_content_lengthsend_r_moved_tempsend_r_invalid_rangesend_r_request_uri_too_longsend_r_bad_version_body_lenresponse.csend_r_moved_permserver_headersend_r_service_unavailablesend_r_precondition_failedprint_last_modifiedsend_r_not_foundsend_r_request_okprint_content_rangechild_statussi_addrsi_errnosa_flagssighup_run__sighandler_tsi_stime_sigchldsignals.csi_overrunsigalrm_runsi_sigvalsi_pidsigval_tdummysi_utimesigintsi_uidsiginfo_tsival_int__clock_tsighup_padsigsegv_sigpoll_sifieldssigterm_stage2_runsi_tidsigchld_run_sigfaultreset_signalssigalrmsi_status__sigaction_handlersi_signo_killsigtermsiginfosa_sigactionsa_maskinit_signalssa_restorer_timersi_fdsa_handlersigterm_stage1_runsival_ptrsi_bandsi_codecompbase64decodetm_zonebase64charsreconvwant_unlinkfile_gmtbase64encodemonth2intparse_debugboa_tempfilebitvalto_uppertm_montm_yearsimple_itoacheck_hosttm_isdstmaxlenfrommonth_tabstrlowertm_minclean_pathnametm_ydaydate_to_tmprint_debug_usageboa_atoi__nptrtime_offset__resutil.ccleanpathcmtime_starttm_gmtofftm_wdayrfc822_time_bufparsed_gmtdebug_level_tablecreate_temporary_filetm_hourreal_set_block_fduri_oldcmtimetm_mdaymonthnameminutetm_secunescape_uriday_tabstorageget_commonlog_timeperiod_okreal_set_nonblock_fdopen_pipe_fdopen_net_fdopen_gen_fdsublog.cpipe_fdstime_sincefdset_updateloopselect.c__suseconds_t__arrtimevaltv_usecreq_timeoutdir_lencurrent_client_auth_dir_auth.cauthfileauth_adddump_authauth_authorizedeniedauth_dirauth_check_userpassnew_aauth_userpassauth_checktempsget_auth_hash_valueauth_hashtabletimestamptimestamp.c]d}dh]h(} dpPp(TPSR(0]08}$8}(DPD[LTVLVT\VVVd V V@ p V8 H VDTlt}(t|X|`X\\X}(XDDXX X  X  8 H XH LTT TT\TTTTDLLT}0\}0\}0 @ p  DTW\WW @ Wp W W W WLTT$T TLTT(T$TTDT\8h},h @ p  DTY\Y4Y @ Yp Y YDTV\VV V @ Vp V 8 V VDTX\XX X @ Xp X 8 X XDTU\UU< D P @ Up U , U ULTVT\V\TdVT V VH V V | V@PVLTUT\UdU U UH U U0 D ULT}8T\}8x<}8<d}8   H   LTT T T 0 TD T0TLTVT\V(V V| @VPVLTWT\W(W W\ WLTXT\X(X X 0XLTT\(  }4 0LTZT\Z(Z Z 0Z]}$}4PVQWRD} Dhth} @XDXLXUXlTlpUpTUDU,YDY $PD[] }$ }(PV4VV@HVVQU$UPUHUUP$PUUHUTT$@TT@PTHTT8<P$TptPPP@DP\tPPPTPV$4VVHTVV@VTV ]} PU QVP\LP]}  P U(HRRHLPP]}$PZQQQ$Q(8Q`xQSSS(,S`dS\\Q$\$(Q(4\48R8PQPp\pxRxQP\QTQTQT]}PVQ 0QXxQx\`PQpTpxQxT]L}PLTQLV] }$ }( P ZQ[ R X]}$]$4}4}DPDTDQDXVVDRDWTSSXVV]} 4 }$P$4 VDWWWW( W W@T<HT`TTR,RSXX0XLXX XUU UT T U T P Ut | U| 4 TW P Wt 4 W4 8 ]8 0 }4 T PT x U 0 U4 X QX | T 0 T0 4 ]4 }$]} $P$X@Z@T`Z`T Z T`Z`hThZTTZTpTpZ@`W|W WPSRRP$(P|P4TTPQRPQR ] 4}PQR4<]<}4`P4`Q4DRDT]}PVQURTPSQR]}$H}PQR,T,<UUTUdTdtPtT<U@UHL]LT} T8}HdPd8THlQQHpRRPPPPtSt8tPP8<]<D} D(}8TPT(T8\QQ8`RRPPPPttSt(tPP(,],}(DPDU(\Q\dQQQ(DRDT]}}PT QxQQRU8DtDLSLdtdhShtH\PxP]L}PLVP T $P$,TLP]PT}$TX} X } DtQQ Z Z W WThT ( T( T PT Q T Q Tt T P T  P  P]} } @S] }$ }}$P$W$Q$XPTPPdTTTTHT}p}}  T}}}VV TVV[[ T[[U$U TUUY$Y TYY$8T\TUU]}}P}l}l@pPPSRD}Dttt}t]}$}}(P(}~}~ } 0 ~0 X }X ~ } ~00Tx@ T T $ Tp t T T TTTT,0TPTTlpT@HUxUU0 U U UU0TUpU~| s S t |t ~0|} l }l ~0}} l }l ~0}} } ~  }  $ ~ } ~Tp} Wt W S W $ WWTpWY Y $ YYTpY]d} PdXQdZ]} PPSRSSQ]D}PDH]H}DhP|PPPDTQTUDpR|RR]} ,SH|S,RH|R]}} PZQXRXUUUSWSWS W SlWlpSpWTS0T08S8TTT,HThlTT$0UUU]T} PTU PP@HP$8PDHPT\]\(}T`P`dSdtPPSPR(,],} (8P8T(8Q8UDLQP]h} P,Q,hV,R,hThl]lt} t}hPUhQQhRT]4} P4U48]8<}<p}(4DPDpWpt]tx} x}(pPVpQXpRZpSY]} <}(P<VQ<XR<ZS<Y<@]@h} hl]l} hxPxUhxQxT]}`} PV,`V`h]h}TT(,T|T(T,T]}8P@XP]}$8}4P} 8tQ8W[P@ThTTU8UUU]}PT(,U,4S4PUpUUPpPPUpUUHV<V<DPDVPV]}PT$4P4@UPTP]}P}PPUHTPPPSPV t @}@t}t}PtPd]d}PlPlTPP U (P(HUHLPLU`pRR VdlVV]8} P8P8@]@d}8P(0P4<P@HPdQ\]H}R(\(0R04\4HR8S`p]p<} `PVP<VW<WtTRSR T $U$,T,0U0TU<T<D]D}]}$P}PPYQP[PTxPUPUVPVXPXQDQTTPTPRRP(S(PP`pRptPtSPRRtRSR SRWPWPT]T}]0}0}(PWT\XxXlRltRT\V V]x} PxTPP U PxUSRSSx]}$},xP U 8P8URR  RDTT0RRtTT<LT0VtV<|VTDTTX\T`TTTTT T\`TTTtTT<TLTV0tV<V|V @R`hR]<} P$<P<@]@}<PPPWtPSPSPSP\`PtxPP PLPP|Pd0TXT]D}PDUDH]HX}XD }$D`P`D VT`Z`TZ$TT Z  T Z T D ZUT$UU T  U T U D Ttt tT t D tpp p` p D pD L ]L }D T PT T P TD h Q| Q Q Q ( ]( 0 }0 } 8 P8 V P VD H P U P U PU]4}48]8<}<t}4\P`dPpP|UPUVV VTtV}$ }$Tt}$tx]x}$tPYP PP(4P4tTtPPTTPTP$T$0P0@T@PPPTTTXPXdTdhPhtTtxPxTPTPTPTPTtUtTUTUTUTUUP $P4<]<p}4HPHpTpxP|]}|PT]}P8T8LPLT]}PT]L}PLTL`]`} LPTLtQtU]8}P8T8L]L}8pPpT]T}PTTTh]h}TPT]} PT]}}PT]P}PPTPd]d }PP T  ] } 8 P8 T ] } P T Q U ] ( } P ( T( , ], ( }( h Ph ( T( T QT ( W( T RT ( V( < ]<  } ( d Pd  T( P QP  U  ] x } $ P$ x Tx | ]| } x P T ] @} P @T@T]T}@xPxT(](}TPTT](}P(T(0]0\}(<P<\T\l]lL}\|P|LTLP]P}LXPXTXdPX\]\}]}D}DH]H}]}P]t}tx]x}]p}$P(,Ppt]t}pxP]}}]}}$P$`P`hRhPPPPP 0P8@PHTP\`PdhPlpPt|]|}tPTtQURPRxSPSHPHPSP\P`hS|SP]}P ] }PTQURV,hRR]}PWQXRU\S\LTLdQdTQTQTR (R08R<DRH\RpRRRRPRPRP]X}X\]\} XlPlU]l} PTTPlT^l^\l\lp]p}l|P|TP]}PTP]}PWQURVP]T}PTUV$TVT0TTTX]X }T`P`T 0 TX TPd h Ph U ] } d } P d U Q d } @ VL d V$ @ T  \ 8 PL l P \ Pd h ]h }d x Px V P V ] }$ } P [ Q T U T  U R` d P Sh t Sx S P S S P S P t t }( p }( l l h h d d (](}LPPZ^(P<XPlP\$@\LXX] } }PTTTTTXlPP]} p}PpUpPPP]}$H}8P}l}l} l d}dl}lH}`pUpT|U|TUT8U8T U THUQpQ $Q`dQhlQQ8@QP ] l}lp]px}xp}lPpWlQpXlRpVUpUpx]x}}pPX|`UUUU`UUUUUxTTTTlT]X}X\]\}XtPtUXtQtWhT]t} LTdYhYdP\dp\D   8  Dd  H  @ p D\ @ | p x h l X ` D h H \  x |  p  @ p  dlX|pxT\<|px(8<@ @ | p x h l X ` D  x |  p   X ` @ | p x h l 0 X`pt(\$\` H\p HX`$H ` P4,4tHT$T@T @HP t ( h t d x < T xT\8@(ltPX,@,40( t 4 P t 4 P t 4 P @ p |$` ` ` ` t  t tl($(    $ \ t $TLTLtT TLT @lxdhX\<L08 $@L $@L $x0 X Tp $ pt,8HLlphdh hl\dX |lxX\8<H@DDH$(,$(,PPPP $ $p|t|lp<lp< tL<t$t|<<LtX h0` $ p D 4P \`tdh P  T  T  x P X , 4 0T8lx8d l8d<x 0x8d<x 0p|(8 $\`lYpYAaeabi.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges.ARM.attributes#(( 1HHT7  ? GoxxTo\\pc ̐ l ` uLLp``${dYd pYp7``ddllttxxHH9@X E0@1lr Jx  0 #+GZ6L@Dp(^8^TTe@4$ (Hx\̐ L `  dY pY`dltxH !    L dY (  "pY)4 BddPll^tk  H X X hY `    T )4h`t4Y 4Y XY \Y \Y X \ lY .  6%DF   []  iu] !| H ] x  P L T`t` \`   Գ س (   ĵ  Ķ \ d d ( 8 x &| T h   x f  &f4  AJ  U c,  pP  d |lT l    `  m0 0  &       m     ( 4  m  0 &=Q$&d $ m, x  $ <  s(&{,&d  d &h t 0&x x   4 8 8    (   t  @ H   ` tt   $i)P |     (        u   \ 'l  -'F']'g$     ` t  n       , D    v ( ~?, @ D    | y    xx4 ` xd          T    l    p  X   ` t t  , |  t     ,! `! 0#  P# x# # # `# # t# H$ X$ $ $ ,% 4% % &% 4& P& \' +?:?H' ( ( ( (  ) 4) ) R?`e * * j?+ + + 8, P, , - - - d. x. P/ x/ 40 X0 0 sL0 0 |/0 |1 1 D2 d2 2 2 h3 x3 3 3 4 4E4 (5 4 05 H5 L5 \5 `5 p5 t5 5 5 5 5 `6 t6 6 6 6 7 7 7 8 88 8 8 8 8 ; ; t< < > O> ? @? A $p$A C ?C TE tE G (0X0G I I hL O$L LM PM M M ,N 0N xP P  S 'xS S .,PS T T @W =PhW W W LX QPX X ]X (Y hH~ddx` p t  td &, 5H< Rb8B0 wȔtE ԔP 8 PX ?) 0 <?I]Pd@=D qP{H Pt5 +   (   % $ 1 ;  H 4] X k ' ~ * @ L X dY # d p 05  4p + |< M _ H m  w <  |Gp  L 5T D P  8 ĕ Е- ܕ@ ?, M DT Y l t x 0GL $ h   - $  pY (d  # h 2 $Q  \ S p 0  P ,\ < Q  & + H l  7 + T> 0, R $d Dh l Qx  ` l Q x   .%:h0  C| M  `q Q̖(#< @ `A ؖP, 0R#   8D .6L 5, CQSe( r P &?س  0Ķ :,NB dQtQ{85 QDPPXt   0S\  QpXl .0S:hL@l ^$Qjt{&(Q,QxQx. 4)    3 .&?, G]Ct fdQt(: ȗ0QQ7 $< ԗ,>Nas< P&8  4QX$ >P 0S8D ()$ 4T C4TPM at j0NH od zĵ  @l 4%h  L5 %L> %X8- K8Q\0 @ 0  @ 0S00 0@ S00 0S000 @@@  0@@zY`0&~ iPN<J0(Ѝ'؍/G-T``pD@ @00bCQ@`  @T:<$$@-@3/0@DsH--/dev/ttyS0/dev/i2c-eeprom0%s %screate socket failed for...maceth0mac ioctl errorifconfig eth0 %d.%d.%d.%droute add default gw %d.%d.%d.%ddefaultTest Network Loopback xH؃ (4,o oo҄` GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2,, xL$mmain/home/usb10132/ct1/bin/targets/arm-vfp-linux-gnu/build/build-libc/csu/crti.S/home/usb10132/ct1/bin/targets/src/glibc-2.7/csuGNU AS 2.19.50.0.1i5،intR8VzsdO3%33<h # # !# "# ## .$# %h# &#4 3'#8 x 143 + F  /  J ,U # '#   xv   # . ' -> O# #C #} # g # #k #u #. #   #$ #( #, ",#0 $2#4 &O#8+ *O#<h ,o#@: 0,#D 1A#F$ 28#G 6H#Hl ?#L H#T I#X J#\ K#` L#d NO#h P#l  , m ,#  2#  O#. H P q  r:# s:# ~ t,#irq u%# dma v%#  w%#  '    ` V ^ [  : H O O N !    A # Y #t yO# `O# O# O# EO8Oc `bPO،"Q"lenR,bufS2~OptT~VLWB^[c\]fd^OJret^Op3(H ! 2  B ? %R " 2"< 2p/home/usb10132/ct1/bin/targets/arm-vfp-linux-gnu/build/build-libc/csu/crtn.S/home/usb10132/ct1/bin/targets/src/glibc-2.7/csuGNU AS 2.19.50.0.1U%% $ > $ > : ; I$ >   I : ;  : ; I8 I !I/  : ;  (  : ;I8 : ;  : ; I8  : ;  : ; I.: ; ' I : ; I4: ; I.? : ; ' I@4: ; I 4: ; I4: ; I 4: ; I : ;  1UX Y 1 U 41!41 "4: ; I? < U%c /home/usb10132/ct1/bin/targets/arm-vfp-linux-gnu/build/build-libc/csucrti.S /0////// $/x9' /opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/bits/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../lib/gcc/arm-vfp-linux-gnu/4.3.2/include/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/netinet/opt/nxp/gcc-4.3.2-glibc-2.7/bin/../arm-vfp-linux-gnu/sys-root/usr/include/netnetconfig.ctypes.hunistd.hstddef.htermios.hstdint.hsockaddr.hsocket.hin.hstdio.hlibio.hif.hKgLhLgj/-K0c/01hj*hLLgI/2"JhJM6xJ///3/I/0(.]J~.fK-~f/-/4/e0 -+//1/,-+//1/..h.4L.p.4L6x.4L/"K"Kv$c /home/usb10132/ct1/bin/targets/arm-vfp-linux-gnu/build/build-libc/csucrtn.S  | LDD__off_tdfIpBuf_IO_read_ptr_chain_shortbufc_line/home/liux/dev_develop/branch/BC-01_release_4.4.4/netconfig/src_IO_buf_baselong long unsigned intin_addr_tc_ispeedserverbufPifreqgatewaytermiosSOCK_PACKETlong long intfault_filenomem_endmagicifru_data__s2_len__ssize_tifru_newname_IO_buf_end_cur_columnSOCK_STREAM__quad_tifru_netmask_old_offsetnet_cfg_tbase_addrGNU C 4.3.2port_IO_markerSOCK_RDMc_lflag__bsx_IO_write_ptrspeed_t_sbufifru_mapshort unsigned inttcflag_tc_oflagcc_t_IO_save_basestdin_lockc_iflag_flags2c_ospeedstdout_IO_read_endifmapifru_dstaddrifr_mac_IO_write_endip_addr_IO_lock_t_IO_FILE__s1_len_mode__caddr_t_possa_family_markers__socket_typec_ccunsigned charshort intc_cflagifru_hwaddr_vtable_offsetifru_slavenet_cfgifrn_nameuint32_tifru_flagsGetLocalMacAddrsockaddrifru_broadaddr_next__off64_t_IO_read_base_IO_save_end__pad1__pad2__pad3__pad4__pad5sa_family_t_unused2s_addrifru_ivaluemem_startSOCK_DGRAMifru_mtu_IO_backup_basenetconfig.cifru_addrsa_dataSOCK_RAWsock_macifr_ifrnSOCK_SEQPACKETifr_ifrumain_IO_write_basein_addr]}L}T4pT,U4T4pUpTTU@HVPLV܇ x|p|L(L( Aaeabi.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges.ARM.attributes#(( 1HH7 ?؃Go҄:To  c ,,l 44 u p X{xxxx  HHLLTT\\``((|`x 4 0~+B$6%Dp%%T,$] l5U(H؃҄ ,4   x x HLT\`( !   ԇ  x (x  ")4BLLPTT^\k܇ ܇ < L L | T |    )4PH\H H l p p    .  :، < E([LlL` 0 4  4@L، Xx   x p.|ARdĆІ܆ -D VckXx܌l $0<H T!`3lJL O  initfini.ccall_gmon_start$a$dinit.ccrtstuff.cforce_to_data__CTOR_LIST____DTOR_LIST____JCR_LIST____do_global_dtors_auxcompleted.5341dtor_idx.5343call___do_global_dtors_auxframe_dummycall_frame_dummy__CTOR_END____FRAME_END____JCR_END____do_global_ctors_auxcall___do_global_ctors_auxnetconfig.celf-init.c_GLOBAL_OFFSET_TABLE___init_array_end__init_array_start_DYNAMICdata_startabort@@GLIBC_2.0sprintf@@GLIBC_2.0open@@GLIBC_2.0__libc_csu_finiinet_ntoa@@GLIBC_2.0_start__gmon_start___Jv_RegisterClasses_finisystem@@GLIBC_2.0strncpy@@GLIBC_2.0write@@GLIBC_2.0memset@@GLIBC_2.0__libc_start_main@@GLIBC_2.0tcgetattr@@GLIBC_2.0read@@GLIBC_2.0cfmakeraw@@GLIBC_2.0_IO_stdin_used__data_start__bss_start__tcflush@@GLIBC_2.0ioctl@@GLIBC_2.0socket@@GLIBC_2.0memcpy@@GLIBC_2.0cfsetospeed@@GLIBC_2.0strlen@@GLIBC_2.0__dso_handle__end____DTOR_END____libc_csu_init__bss_end__printf@@GLIBC_2.0close@@GLIBC_2.0__bss_start_bss_end__sleep@@GLIBC_2.0_endputs@@GLIBC_2.0tcsetattr@@GLIBC_2.0lseek@@GLIBC_2.0_edatastrcmp@@GLIBC_2.0cfsetispeed@@GLIBC_2.0main_initlpc3250/usr/bin/Cabinetlayer0000777000175100017510000134435413635025736013641 0ustar 10011001ELFa( 44 (444LLܛ((( Qtd/lib/ld-linux.so.2GNUaw:jrf9tsYhg"aQnJGWmPL0lq(X\3vb,_NipH16[ DU5$e@OR?; dC^B]VI/%TFuo2= &!>*. E' 4#8 -S<ZA)+`McKk7f,8DPf\ht  Ȗ Ԗ2 $\(4@L2XAdp"|8ėЗܗfS, A|$0k<HTu`Olx{sNl+ؘ̘w'; y; 3@ ,]8D:P\hWt9C_Wșz; ԙ$; U (g4@(LzXEdpB|VXĚ:Кܚj libiconv.so.2__gmon_start___Jv_RegisterClasses_finilibiconv__data_startlibiconv_closelibiconv_openlibpthread.so.0pthread_attr_initrecvfrompthread_mutex_unlockpthread_createsendtopthread_attr_setstacksize__errno_locationlseeksendpthread_attr_setdetachstatepthread_cond_signalpthread_attr_setschedparampthread_attr_destroypthread_mutex_lockpthread_selfpthread_mutex_destroypthread_cond_waitreadrecvmsgpthread_cond_timedwaitrecvpthread_cond_initsystemfcntlpthread_mutex_initlibm.so.6tancbrtlogsqrtsinpowcosfloorlrintflibrt.so.1clock_gettimelibcrypt.so.1cryptlibc.so.6_IO_stdin_usedsocketfflushexitreaddirfopenstrncmpinet_aton__strdupcfmakerawperrorclosedirinet_ntoastrncpy__lxstatselectreallocabortvsprintfgetpidstrtodcfsetispeedfgetscallocstrlenmemsetstrstrbindtcsetattrfseekstdoutinet_addrfputsmemcpyfclosesetsockoptmallocstrcasecmpopendirstderrioctlsettimeofdaystrncasecmpusleepif_indextonamefwritegettimeofdaytcflushstrchrfprintftcgetattrcfsetospeed__xstatmemmoveaccessmkfifostrcmp__libc_start_mainfree_edata__bss_start__bss_start____bss_end____end___endGLIBC_2.0GLIBC_2.2GLIBC_2.1GLIBC_2.3.2  H ii / ii 0ii ii k@ii ri ii \ii ii  <a $(,0 4 8 < @DHLPTX\`dhlptx| !"#$%&')*+,./02ġ3ȡ4̡5С6ԡ7ء8ܡ9:;=>?@ABCFG HIJKL M$N(O,P0Q4R8S<U@VDWHYLZP[T\X]\^`_dbhcldpetfxg|hijklmopqrstu-MuD- Ə`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌ|Ə`ʌtƏ`ʌlƏ`ʌdƏ`ʌ\Ə`ʌTƏ`ʌLƏ`ʌDƏ`ʌ<Ə`ʌ4Ə`ʌ,Ə`ʌ$Ə`ʌƏ`ʌƏ`ʌ Ə`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌ|Ə`ʌtƏ`ʌlƏ`ʌdƏ`ʌ\Ə`ʌTƏ`ʌLƏ`ʌDƏ`ʌ<Ə`ʌ4Ə`ʌ,Ə`ʌ$Ə`ʌƏ`ʌƏ`ʌ Ə`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌ|Ə`ʌtƏ`ʌlƏ`ʌdƏ`ʌ\Ə`ʌTƏ`ʌLƏ`ʌDƏ`ʌ<Ə`ʌ4Ə`ʌ,Ə`ʌ$Ə`ʌƏ`ʌƏ`ʌ Ə`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌƏ`ʌ$  --0- -00 0SX0p@-0SpH H0`0bC1@C8P 0S :0 p - -0S0S3/- -LM 000 000 00S 000 00, 0 00 c 0 00 000 0S 0 00R 00 0RD 00  000S 0 00 c0 K -LMd10 X1 T1 0S D10S 41 ,1 00c0 1 0R *100 000 000 0S. 0!1000 0S% 0 0 0 00 00C0 0$ 0 0$00 00C0 0SD 0080 00, 0000 0 K0, -LM 0!20b01 0#3' 0Mb -L$M $ ( ,0 00 10 1 10Sb10Sj0S 100 0 x1 p10Sd!000SE  00 ,00( 0   00 0 0 $0 0K- 00R: 000c}S00}/0 0 000c 0 0S 0S  00 00H 008000 ( 00000 00 K ĩ,04 -LM 10 1 10S100 100 00 000 0R 0S0SE  0R00S@!00000 00000 1 0 0 00S 000 000000S  000 000 0 x0 00h 00\0 00@0 0^0S0$0 0$0 $0 K ĩ0, -LM4or0S00 00 0 -LTM\ 0$0 20,0 X0KFT X2 ,H20 0 d0K;d0KX0 T@ T 2 2 0R*20 0 1 0 c1R1 0 1 00c 0 T 1#30 d0Kd0KX0 T@ T00 AW0$0 |10(0 (0 0RF(0 00b 0 (00S(0 (00d(0 (002/(0 0 (00S (0 0 (0 ( 00("00S  (000 000 0 t0 (00d (00X0 00(0 0 c(0 $00Si4Mb0, -LM  00S <0 08#8 00 0 K -LM  00 0 K -LM  $0 0S00  0S00 0!20b01 00#30 $ Q00 0 KMb -L M 00 :0 K -LM  0S Z 00\ 000 K -LM  $0  00 $000 0 K -L M 00 0 K -LM@00 0S R  6400 0S F0 0 *(00 0S :  00 0S .0 0 0K@ \0T0#C#?c @00 0 0 K@ةLt LMbP -L M 00 00 0S0 KЪ -LM \ -L M  $0 00  00200  1R0(0 n0"1 b100 00Y0S>0000$ 0,0 ,0S ,0S:,0S  0,0 0,0  0,0 O0(0 50 0,0?000 0l0S~0(0 w00\~0(0  00@00 40 0 0 m0(0 (0 K@\0` -LM 00 lGh100 00 0"1 bD100 0 0R 000  0R 0R7 0$0 10S 0 f00 C0 00 0"1 b000"1 bl000 000 0 C0R000 C$0 0$0 $0 K@\ī -L0 -LM0 1K00 00  00 0^ "10b000S 000  d1R T1R@D0 0 F0"1 b$100 0 00S 0 0 0000S 0 0 " 00 0,00, 0(  00|0 0  h0 H `008 P00 0 }0 0 0 K@80d8] -LM 00 00 00 R00 0^ "10b000S0"1 b\100 0HL"10b00 0R 000  1R 1R30$0 30 0c000(00 00S 00000 00 0S0000 008 D00C( 400$0 $0 K@8]] -LM $ 00 00 00 $0S0(0 j0^ "10b000S 0"10b00 0R 000  L1R <1R$, \0(0 =0"1 b100 00 0S0(0 ( 00 $00000,0S 0, 00 0,0 0,00, 0( 0 0L00wu0(0 (0 K蔬@]8 -L,M( , 0 0 0 00 00 , 0000s 00S080 080 800 90^ "10b000S 0"10b00 (0R 000  1R 1R#(040 W0"1 bl100 L0 0000 0S 0S040 >040 80S040 20S 040 *000(0 0 0S00040  0 ,0 0, 0R 0,0 0 0( 00040 40 K@]$8\ -LM0 1K00 00  000!10b0a10 00S 000  x1R h1RPX}0 0 J0!10b0a1 (100 0<0R0S sd0 0 10 00S W0<0^0 0  00 000 0  x0 ![0T H d008 T00 0 >0 0 0 Kt @0h< -L M 00 X00 DD0!10b0a10 00S 0!10b0a0 100 0R 000  0R 0Rڠ!0!10b0a1 000 \0<00T0 0T 0T0S0 00<0 Kt @خ -LM 00 00 +0!10b0a10 00S0!10b0a1 <100 $0!10b0a0!100 0R 000  0R 0Rڸ+00 #0<0m0<0x0<0hh0!10b0a10 008 L00C( <0^00 0 Kt @ -LS 0nS0<00H0 0S 0<0x H 0T0S0T0 C0T 0<00H0 H0 Kt @@Mbl 0-LMP,0K-,00 (<0#C#?0c0 $0K K$0KK0Mb 0-LMP,0K,00 (<0#C#?0c0 $0K K$0KK0Mb -L,@ -L4@ -LM  00 -LM 0S $ 00 00 0 K踯 -LM 0S  -LM 0S  -LM 00 0S , 00 00 0 K@ -LM 00 C0 00=9 = 000S 00 0 00=9C =C 00 0R?B -LM  0 00 0 0 00 0  K -LM  0 00 c0 0 00 c0  K 0-L MP0 000 0000 0KK?0$0 00L0#C#?0c 0 , K 00$0K,0KK0 Mb M-L(M4 0 , 00$0 0(0 ,040 040  000 04$0 0#<0K,0#,008#8400 0#,08#8400  0 0[00 $ 0<0$0 040#4(0 0#<0K00#80 0#80  0 0[00 ( 080(0 08#80K0[S 0 ,00( 0(0K4 4K| -L M0 ( $ ,0 00 00 ,0S}0K0 h,0#88SM@(0#8,30800 (0#8,"400 @(08#8 (0,3000 (08#8 (0, 400 @$0#(080,30800 $0#(080,300 @$08#8 (0,y3000 (0,q300 (0,300 $0,e300 0K0 0K褰 -L@MP H D L0 0 0 0$0 D08#8@0 D0#8<0 H08#880 H0#840 00 *0S00C/ 1K00 L0#8/ 1K000/ 1K00 L08#8/ 1K0000C0 0S @08#80 0 @0#80 <0$000 800(000 00$000 ,00(000 080 0 $ 08#80$0 0#<0K [<0#<00 80#$000 408#8$000 00#,000 ,0#$000 (08#8$000 $ 040$0 0#<0K0[S 40S 40SH0#(L0#8S H0D $L0R$0KPPKȰ -- LMM $ *0!$:0S* 00 00 00%S000tS0K >K 0C\ 0u00 000 >K 0C0 01K>K 0C5 K9  -LM00200 K --LMM 0 :S* :S0.00 00 00%S000tS0K >K 0Cl 0'00 000 >K 0C0 801K>K 0C :S K脣 -LM    -LM  0S $ 0  K 4 -L M~/00 0S  00 # 00 0S  y00 h00 0S L j00 0 00 0 K; @; @:  -LM  0#30 p0##30 0!20b 010c0 0!20b010 0K0 0C KMb -L M00 00 0S 000  ;00 0 K蠣 -L0M( 00 (0Sh, R(0,0 (0, (000K0[S 0[$ 0,0 ?(00S0[ , 30[1!0! 400 00S 0[ 0,0 (0,00S0G?_00 0S X, 00 00KC0[( 01000 S0C110K0[( 010 0[S [[0[( 0100 [0  00[( 01 0[00[(0 10000[( 01000000 0[00K(0 0[S:(0, 0 !(0,000S  0$1 0(1 0,1(08 0R * 001 [(0800 0D&(08 00!! 001(00 0$!0$1S  041(040 0$2"0(!(050 01"0,!00K@[0[( 0100!10b00[0[(0 1000!10b0 0[[00[!10b0  00 0S 0[[ 00,0 .0[00K(0 0[S:(00 0(000C!10b00 0[[000  d00 0H 0b, ,0 K(XD: PQBس 0-L(0 ( 2R<000+02K<00 2[(0 202K2[S 0 [4[<000p 0 @ 00 !0S 00 0 [4[(00( 0n"[010"c2#"?0c2K<00 2[(0 2[S (0 0 0S 0S 00[4[ 0H0@0 Y<00S <000 <00 01K 00  00[0 40[0<0!1[08#(0  0 0 0000 <00 00 0 1[01K![2[R: 00< 00<0!2[08#(<0!<0 2[08#(<0 804!(0 804!0[40["[0 0 0 @ @0 KxB<Q-\1"A! }D/X 0P/ / /x / 0/x /x 0/ 0/ 0/ 0/ 0D @ / 0D/ / 0Y/ 0X/ 0XP/ 0/ 0/ 0/ 0/ 0/ 0/ 0 / 0 / 0(/ 0(/ 0 / 0 / 0/ 0/ 0/ 0/ 0$/ 0$/ 0-/ 0-/ 0,/ 0,/ 0./ 0./ 0// 0// 00/ 00/ 04/ 04/ 08/ 08/ 0</ 0</ 0@/ 0@/ @0 2R0R 5R 4R/09S// 0/ 0/ 0/ 0/ 0/ 0/ 0/ 0/ 0// 0// P 0 / P0 / P 0g / P0g / P 0G / P0G / P 0' / P0' / 0/ 0/ 8 (0S4S /0S0s3/ H 020CS /09S// $04P2P/6P5P/ 0/ 0/ -Md<0P R R0SЍd p@-\@P`? PRRR G g p@ @-da@P TP PP @P @( P @`  A-@M0`PpP0& @TpP  0 S0S@TPWЍ@BPPPDP K ` D0@-@zMy/ AB P 00 R0 1B1@P y/lB@P y/zߍ0<8( }zx h|D@-DB@P4 da舺X D@-(@0S0 0@ 0@-0P@..0  0@ x 0@-,@~$ 0S0@  @ x p@-@MdAv`P]PR.PN@00@T0 qPaz P J.!1S#BG`P^@y/ 00 R0\1y/1`ލp$(._.V`PڰP.\P .=t T2HPHTL.'0hx |ܺ Dp@-|Pdp@P PLR  Pg P}b Pav0 0VS)PP9A P"`T 1 ?"D    (  $ - , . / 0 4 8 < @ "p@8"4k000000000 000000000IBxLx`h@H  L`X  4-Pp@-PP <D`w@HPb p)U<=P@g U`PF pC`@P ,/ 0"b@ U P;p`@6  ,/ 0"b@`@%O0Bd@@<S@,HM,| Ϡ0l@ `={pP@  ,/ 0"b@ꉈ0@-}M xPP#Q@YVPP :Pdd :P Ѝ0DI8E,(?ꈣ  `t@-pM `p 2PP @T.d}P@|x`pLTP <@}+ ( f-P`PP00@-SP( T@P 000000000000  00o!P0 000D{@2@@@@?0l0D, O-M @ 00Z p `P P ߍ0XS   8 <0 t0 00`IOⰀp岐A ,@ $PPE@ 0E!P& >P  0S >Q? > 0 0 0@`P@2 =lTp@-P@!/0"b`Tpz!P"pfP PpnIP pT/P pP <S<Q<p艈0@-M,.. * PP<P00L1@΍ @ P00 vP00*P00P%P  "<<!4,4 0 1ލ000@P @ 5 <<("4 4 0P0000 z -= PH@-@P @v- okgc_--?@ 20 Q$ 1!00c(0-pTPꈣ@- @P 00 00 0P  D-M Ѝ- P0 -M P P0 @0 $Ѝ  0 0a0 d3 G-PM  @PT (PP tP' B@P( mP{B 00CS02 R]<嘂0pCWp! "00CS000 Ѝ@PP P~P@zF PK 1PPm䑟` l@DOKIO y@P^`x V# {b}8Sa Q] A"10@cwq@iTdhKK?0_PglPdyPd2PaSP^`@P[PX S Pa _|uꌣ 98E-`M0F%SPS$SG| T t4t   X    X`  d$`    0<SP1 Hlp}Ty8Xv<sH$m4뤾̾x@ 0$t0/` 0/` 0/ 0/X 0/ @-TMwL0@@@<8 :PЍ~ H, -0S00{0   ` 0@-S@ ! 0S 0 `R &1PpW* 000 R 00  `HD94 00&100 0pdx2"G-3#ŸCM0@ Ppb"@P@pPP p ps @*6A@R@p 0&100 PPU1@@PZ0p!@ pPq夁夑0S(@T3 @T- 0S' 6! 0S 08(C"Y#(:: P8 0! 00 @ 00S P omCߍV@Q|0  d<9x6xP `-H*Psꤣ< d Կ ` @@-<@8f|(S-0S  QP@-@@40Q 3  襣? QP@-@@40Q 3  褣g  XA-`M0S(  P0堀#100P p HTЍ 0#10H 00 P0 0La \ꤣd X-P0X ,0 R/ 0 R/ 000 ` X \ -0S L0 D0R@ 40 R0C0 ` X  O-鰱WM! 1  `PB PP 00B S 0/S9S  0C0p W!300Z  @P m7Wߍ0 eA/vP1: S I@    y0p00,,d dp@-@M  i0 `S  a0 10P HTЍp 0 00B&  B ꥣ? @-@ T!00 0Q"0@< -需`pP @ `P(@ pPw @00B S 0/S9S  0C0 \@"00  R P0-0 -PP7: S 0@ .R0mS 0pS 03S 0|@0P$R  #   4 0$@,@ 4(!P@ P (@ 0 0 ( 00(  4@0S 0u? 0 o 0\j /J`F4d <  \ 0@-T@ LH0P P840, P $- 0@Pd < X$-E@-4oP(@,o@Pk00\ 0/0 0-0@hS 0/0hS0 ĂQPLU@ @0 8#(R@ 0S0S@-0@D 0 0   @p 0@-  M2@@@@@ @@@ ,PU EPP 1!1 :RP/pp :IP0TT :@P"88 :7P :.P b Ѝ0[VQLq !<(<"4D0Q0 00( (000L p  0 , d 8 UD 8D< OH B@ 4;0|T!̠8̌0@-#Č M@ČP$ 0@^# Ѝ0@-xM@ @'hPP# 0H@P48#8'<00 @@@0p@ Ѝ0 $PPE-@,Mp` (`PPR$̠8̌,#ČČ# 0 $@P (0@P  P,Ѝ("48#8"<00 @ @@0p W 0'x0$I l 0@P 8v@$q0l PC@BO-p@pQ@@MTjc0  0VT`pV T0SL0@hD0X@PpH ="P 0S5 3 " /7 ^0  000000zLP 28!P,000SPLHD@<840TS 0l 0 0 Q 0 0IH N 4  h       xp F Htl<M D0-0SM  0 ЍЍ8d  t@-8Pp#h @P 0U`00P PLH@ P @ D@- M*@TڨP0 p`00 p`P#0S XS$D 80,!4 5 xA-0@P `p 8 @<(T0 ,M  U$P 0P ЍPR @P    Pc0" [X;8 DO-@qM,A^ D " n?n@P   )1!9!" 8 #, 3`P4!P~⦒0P0Sq? AȌ L 0P* 038 ,$l΍oύ  0>@P0S0S ΍ @0A x1#("< @1D# ( "< `Pڦ  4 @-MI   @ mP0 0X00!S"%H H0 $$ #I kЍ`P0 0 , @-@M@0^  0S00dЍX 0S00D0 @V(0( ML , 4 0 d @-Me @48#8 800.0? <(<"4 40? <<("4 4 0P <(<"4 !@4 T1 @DP <(<"4 !@4 T0FC/ލ0-M0000 00P00)P0000  P0"0ЍP00@-M@P Pߍ 0R Q000CUSKJJJJJKKLJ,LJJJ`LLJJJLJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJLLMJJJJJJJJJJJJJJJJJNJK  jRSP Q% ]dC.#$ " ?,@P  , (6#8#" 8 #, P#0`2 㞟 0 00S Ap0CȌpÍύ  0PM p138 ,ύ  0P@Py40 S(SO )S S S 0R Q X\`dhlpt6 P x|倳儳刳x ?3 #("<_3# ( "< PPڪ |Si S )S33^ @W<^ 0$\ 3\ Yd3 R3 ß F  =#0AS0RT#xY40(S8 : DQ) " 0 0R?, Lύ@0P= P  P 3 ` #Ý"("$"3 ,,#L,#X#1(01$ 01!0 !1AQJ >301 f|1 _ 8<@DHLPT4<<:PP  ~ P ~)ύ:@ 1R~ SBP @P /0PHx3|3x3333< ?>@i}} ~L , d 4 0 <(Tl@-8Pp#h@P 000 0`PP ' !DH-$P`p@-@M@`bPP m P@Ѝp` \xA-@M@P`pCP 0T00 0? T, ("0 @Ѝ00 0E0F.S1`________`T`_____________________`________`T`____ 0 0(!(0 q - U' U@0 0nV000@P0@ 0@PP 0,0U0 @0 0 0,,00 0,00 zxG-@Mp`ᐠ댐PP<U 0S@k @PP<U@Ѝ X0@-MPP N0p@ \\ :P @Ѝ00$/ jH4QA-PM`*Q~00   @}p炏}0@S000@  @rB A CU0 ,0Pڂ? ~0A2Lߍ謣@-!X U(M`p@# $0 0pH(Ѝ-M0^00000\\X0% 0  ЍIG-0M` @P0 pPP p0 0p h ЍA-M @PPP0`` pp0 0pP FЍA-Mp P@@0PP ``m0 0`@P !yЍ ̠8̌0@-#ČM@ ČP 0 0 P@@Ѝ0@-0M @0@QЍ-M 0 0 AЍ-M 00  Ѝ@-@PMI QG0 0C%SAXhgph8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8h8hh@h-P 0S P0Z PS PQ P\ P_ Pb Ph P @=ЍR> 00 0C S ihhh4i ih Bd         @P   @ @P  P  - M00 ЍO-MĀPĐ `0  XpP@~Q$`` }Q 00000 SH0`ȅ`@T~Q 0S0@ ! `/ . . P0@-@MPL{DxЍ040 ", AP00pg?0@-PPPUM@ Ѝ0Q,0, "P괣g@@0@-Phl`lXllP@U@ TUU00@PPPPPP-40Ma P Ѝ谣<Q@-0@S4m4mlm4mA<<S<0C1@(00A@CJꔹ<Q@-0@Smmmm@ ! 0` H< PD*(1S<*@0<P8  P ( QZQ 0P HH:< (xP(0P `$4 Q ZQ 8 0S 0AS8G  0S S?0 0",!̍0P  !0`P `0 R7  $?P7 !, l  1('S!<00"0S,$0!|0p  ' !,$ p@ BM0@<@D*Q 0  D6\61 0X0 < 0 0 0A-0C0 0`0Ɵ 0S 0ZST 0 0R " ş00 R @ PL0TL5 0 S10-t4 PʍQ  0\au \ \pPWW`@ 1 @?@1P@WW0 WW1 ?@1@W0P UYxPpP<ğ0S0SS0 S3! 0 R  0St{P@ pn$3ʍ X17`C!0P !,0 `P ` 3! 080̠8 C,3)PLL P^!̍P@8 @0 `DD-|1z@Bd+ʍ Y%@"kPA TP(02S00 YHR`A=00`T @@P? P0@@ d4;P/ P00.0A=00!TYP%Y Y T8 ((  p!<PP 00TP 00 0P M0ut'$Ĺhdd T? ԹP? / ? P<,DX@-DqM0P0%` 0P,0 S* `X|@P 000000`FxMP: 0P @`d , P0#  ,<cP 긣D(0-puP긣0@-M  @ PP@  0p@ Ѝ0-M 0   0Ѝ-M 0   0ЍM@-pPWP@|x@Ѝ/0PS @T *20 R 0 @T: P7  2`!V* `P2 20 20PU  0 0@P T:T_| 0PUHnXk,gDa0^O `T0M@-pPWP@D@Ѝ/0PS @T *20 PR 0 @T: P=  2` !V, `P8 20 20PU   0@P T:%T  0PUXh,D30O `T0E-0hM0` @-PPP X&  ePyX0iS ,(hЍ Y0DSZ0sS[0tS\0eS]0FS^0iS_0wS`@@TN f gd(e0, $ \} ,0RD0Sp"GX0 0Y b0c`8a <04_^\@]P0f g0d(,e0 $W %* 2"pP hDpP>\88H 20, .yw T@-@P7 @-SM0008C:;b p0! 00! 僰 40 ZP`@(0C8( x ;C6S0d PS000Z` @ 0 S 04 0 0pЍ/0S1 0c/ -` a@-!LQTF VA  R bS0cR \Vq8#8b ǂ\F @@ 00 0@0c! (K1\@ RT0DXPP 00V  0S0cR V!ʼ-PP -LM @'\`P{;\{{ʆ 00 c 8 - b- b-1V10 40   00b8#8( V0BUX 0SI  P, V 4@0 0S0P 0PR 0  iV @  p1R  0CV  J10804 0JS0000ZL BNA,(K P, c\{|Vӣ P @0 0 a08#8(V0Bʎ?o@-@cT0D0dP339C9C88##@#!B4 b'+x (BȠ "(9B78C8T'B(BȠ "(9B78C8 ("(88C8 DC8 dS/P- h0P\0P T0TP 8088 ~0 wTDCLDLxD$ -L/8 S< d  d @(R! D E.aE? A 8 @(0\Q80@ @@p C8l < A0 @0d h X@ @DKl@1`0 0T, 4 P T H0  t\ `@X 00L b cP\ p0DX@\ ! ޿t RD0)H x1p aT 01 Rt0pS P0 P00bL0<00\ !0 h XpPA| D0\@B@1 0C80! P'!10AȠ(C8"( P6\S2 >08C8(A"(6\ PS1 B=408C8(A"(5\S< e=.08C8(A"(p5\ PS1 =908C8(A"((5\S< =<08C8(A"(4\ PS1 :<08C8(A"(4\S< E<08C8(A"(H4\  PS1 Q<08C8(A"(4\S<  ;08C8(A"(3\  PS1 f<08C8(A"(l3\S<  !o< L08C8B("( 3\ PS2 !v<!j08C8B("( 2\S2 !{<!08C8B("( 2\@S2 !~<!08C8B("(| T0\R D01T0@ 4 R0<Q\ <@00 0T0D4 00\1,n <0 S0 0P@TD<\01 08P@!0Q0H H , P, 0 80 00 L80 'l@T+`X 0t0L b Q c\ P+D X t @@t0/p<L0@P h d xd (K~{ivKof\QE:{.x#m Q0@-@P" PQ 0QQ PTHXP0@L0LH 0@X4044 0@R0 0@LDLLCDTTDCLx0@-@P& PQ 0QQLXν\̽`ʽhȽPƽTĽP0@L0LH 0@ 4044 0@0 0@ELLCETTECLLE-P`PHUMd[P@pR T! 00; P 00`I 0*L P@T<3HC7P0`SX L0S T0S P H0S Z00KZ0@0@Z00@@@0@< 尽Z0@0@Z00LCDTTDCLxG-`pPWV\lPPa 10   `4 0@80<2pL@@@ @(@Լ0;Xͼ\ɼ 0`ühῼPỼX0ST \0S h0S P0S P Y00Y0P0PY00PPD0D@ 5Y0 P0PY00LCETTECLx-p@-PP 2R 2R 2"0p@ Ѝ/2" 0 `R- @P0 Rz R" R' 00S<  42R- R@0TX /C0T:0L R 0000 SS000ճ0 S  0Q0 Q4000 @S000X!`0;\! 0h  P !T0@(0 0<2B<@@@D@H@d@0@` 0mPP000d P00@@0@0[0, j0TTECLELL'. -LZMp ^8 `@  <^ <|,F(K\<\\,=OP0v030X0T T  T T   0PS050   X0 0c0c0 0 10 c(!( X$ Ȼ Z b 0 1P@0 \$ښ@#(1`  P 1 h! 0'Q-B! B7=08C88'j-B B(B  0 R  410!"0S  0S @ PU 0 0 #04P U |ğK T TAZ: @ P P! P0P`0P P0 XA X\X0 P0 bS0cRK0 K00X1`0QX1 P ʠZ @0@A PKS࠳S00^00SQ 0^ Z  0R `0 LQ \  P @D! \ 00 0cR.`1 SL1 D\@0 Z0PP `P  0 00 c( b( 0 ! 0 P0:**Q0 R0S+   R_ A;QR;RPW !  V BQ 0S @  0R000 PP$ (0q"P  0@0 8hP P0 0P P P0  TECLELL@`$I ffP 3  / PU ,l , $ 8 P 4Q     0 @L 0`1 00 c(P c(R Q   < 00bC3S0^ࠡ h1 00 c(0< 0PP 08R  B à! \ɠ ȠLȠ   40 00 ch0 (P\ @Q   P 8!V Z^P P!/0C"BPP D@1OD!C000C@10S0H@T @CT@2T@Q! 0H0@D0@f0c0lC8! <' 0bQD0<@ 0Q>0BC30c# @< P HK 0  ` 10`cSV-00\'/-B B7-<)08C80@'Z, (B(R<388##8 Xp0 RP$8hL@Pi8C8 Q h5<  40" R-B( B0c761!X(B( RCT8X|ӭ0 0<\0   08C8 QB@1S<0S0 0 S80p0;0nSx8$80L 0 0p0 0;0bS@0SP\0 TX0 B`  X \( Fhxl@$a1EX@0lPdp@0t 8phL0l 1`phB(@Ƞ"(  0707(C80"(h@&h07dl8 1L@ dp8 0PBL@("(P LȠ! 0780CL@7C ' C8 0 L PHLA$H 0 70 0 LPL` 0  7C0C 0p$ t0 J ^`p D\TP8!CHP0x 80C8#8 'DL0$\ L |x\0 0SL |x8x`PPڐ k{k6{*oAA9CȠ/ob^0N0n\339C9C88q##@#!B4 b'+x (BȠ "(9B78C8^'B(BȠ "(9B78C8 ("(88 N nC8C8S"" ǠLȠG(8#8 8#8DH!@8'G'B BB(!070 ) ?o0c0CQ0aRA!A`7j>0\'/-B B7-<)08C80@'Z, (B(R<388#(#(<Pl8< C08C8'  Q\8] P0L K@4@64 (@"(L70c0C 0^08 |0X ?hffff8(L \ 1004@尣_H`PpH0HP  8p8'b0 ';C6 S 0 S 000$0 Q\H\ `p@8`P80`0Mߍ ۍ8U\ 10T00%z@pP` -LMp@P`P  <:P 4:40*ұ(K:*ʱPZPX QY 0Sp  ^P Q00p0 p00^'/-B B@7-<)08C80L'Z, (BQAQ@sSh-M @8S0  =Zp308@ 8P01` 0bS0PQPO?ocP|0@S08C8U!`\DQ z#@! p Z0@ SЍ/?o0c0C0S0cQAl1A@`7j>0T'/-B B7-<)08C80@'Z, (B(R43S0T'/-B B7-<)08C80L'Z, (B(R4300  Ґ`0@<8C8U!ʀh O-@MP@`8P 0 `@fW$ 0R bS0cR ^࠱W8 ` 0R@?o 0cAÏ ` P  W  @ 0 S8cR(9`(0B(C8 Wc&R%)!80 SE!#3!B1C `0a!1 `0a7 @$08C8 SpyY?o0cÏ\ P' ?o0c0@CQ0a\A#APd7j>0U'/-B B7-<)08C80D'Z, (B(3RU8CXP`\ @) ?o0c0@CQ0a\A$#Ad7j>0\'/-B B7-<)08C80D'Z, (B(R<388#H#HP=0 S ZY@2@"!B 30b82C0U'/-B B7-<)08C8'Z, (B(R5("(0L3c8#8?o0c0@CQ0aPA A`d7j>0V'/-B B7-<)08C8'Z, (B(R6B(`70D38C8B(`. hG- P$ (`!@8,#(U 00P00Se?o0cSP#Q3(80c#Ƞ"[8CX (B# @+ ?o0c0CQ0aRA0^'/-B B7-<)08C80L'Z, (B(R>38888CHCH8#H@8#(Y8(PCxBh@ C7B'PA7L'bY0 @ 0#3(8#Ƞ"A-hO-MD< P㰰@80   QRX  0!H0\00S 0p03Q0S > Pl D0S勰 R 0`აq @V ڰ0  bV' 0ac70ʸ\ʼl @ QPül dX r0+ 00L0Qʸ=h `D R0˰t\ P pÉPA[ ڰ0  b ^' 0ac70pQʼ 0+ /h0帐0h0 L Yڸ0H dS  RP . H00;  PQÞRڰ x 8 0A0 40 +X0 d0l 0 h H S  RP \DPtQ  ] H00X0S x4X@x <T0`R00€ S04 8C8B0C!A0 A2PCPPD RP_ T0S <@x8 0 Bx 08x 0H$HHDh@xVxPEX@H?$HS  :@ P *A90#8=C'0C8C8) "( B(B(90#89C0C8C89) (090SYT : D R# @ iPV  Vk 8C8(Q8AȠ !)'-  97w=C#0C8C8a)@8S8C8\0p9f8C8Q`8AȠ !)'-  97w=C#0C8C8a)@8S8C8`0.@*x0 C@`C!0˰SՌф8僐Q p@[ ڰ0  b[' 0ac70ʸ pRb8匐 q `@V ڰ0  bV' 0ac70ʸQ0SD\ @@P 0SV0@0C0XQQ8   Ѝb p@ $<1 2P'00 @ R0 Q 00S00 R0 Q``ц0P0 c0eSP `e0V0? F 0 \P `eNLD R \8 0P\x` R W" x0S\ 8C 80 x 7\8 0` 8C 0 x 7\ 0P0S \e hQ d0|0t3 pt|pQ|P8 0`U @ ڰ0 @ bU' 0ac70|0 S\! |Q0 `U @ ڰ0 @ bU' 0ac70|  Rt0h0\t0lPT 2|PQp8 0`W @ ڰ0 @ bW' 0ac70|0S\! |P0a W @ ڰ0 @ bW' 0ac70|Ql  R|00|0HP \X0S <0@8 x x 8x0x d08 0sD\x`ZhH}Q'P;   ` P`\T0xQ00S 0V V D00 e V`` i\p` 78 `p  $ e@iP@D< 0,@0P@(Y` DP  f 8C8p0(S"(!g880x puDQ8P`; @R8P0S7 0 B0C 09P X@\0P R90 S @0O0C0T00C099X`P0PPH0\00S? 0@0b H?pe\0S0Q4 e oPMT RI PIQD0`S0b U @ @V0D @@U 0iP+@'@P`@8 @R0 S ڴ00C000C0XPJTP00x @D@< 80 ($@`,@f  $xD@< 0P,@@(@0pp0S88p 0(b8c cR``8  8 d 8P d 2+) ?o0c0CQ0aRAh&A`7j>0\'/-B B7-<)08C80@'Z, (B(R<388#(#(Ѱ0S8CȠ80  7R 0ʫXp@P80  x p [PXEX@TH?$HS  7@ Pŧ'A90#8=C'0C8C8) "( B(B(90#89C0C8C8@8) (("(+b (B(d | pR\`(`@f-p088804\``(dh00 P`PDV0@ ^iP D P`0 -LM @Pd (p h  \ R X hR a  4\H ` l0 p 0'7 0@ 40 !  0` Pp 8 D < @hpT` e$/d0h  DW`h @hg0DQ,0 8@0 H0  1e PP@@QT P Rp00T0 p t l \< 0Lt(X T$,K ($ < `d,P@0"dp 04 S80 4 80 څ0S `P  \ 0L 4L \0 `0Q0b $(KP/ A0 B  0/᫪-M`0 V@ p 00C1 R10CD 1,@#A!SP0 嬯!A  0D 1[p20s@ 00@ V  10C !@0 0 W 10C 1"APR0!K[I0!   Ѝ/-Q00 MP0 S00 0 0k  00C10 SPK0ʃ`pYz P@ @00 P[ 0 @!1P@0 T0 :1p0CP 1 Ѝ/1哢*Q!PG G "/o b@Bd:ĠF0 8A `URt A1<(  Q jp `00C00S00p` 0@/o b0L@-@ \ 0L# B 2#0l00LĠ (032Č@D0S P / -QLMp` R >000 1 00, c-AA FP.%\2 W, U_V%څp00  R !R 2Q0 Pb@ 0 Q:U 0! V ,(K0S00S 0?o L  c0N ^N 10C <0n030N (032L0S P0PV@,0 W00R00(0FS0!(S"( Q pcP 000H A\:W 00V ʖ '''>p-@`,AQ0 C0 ς/#/BSP1Q00C0   @/#/BS00C  @\ A 0h0 B0@/#/BS @0(0 BB$p/000Cꫪ -RLM`( p% 0AS#Trxrrpsq K @P ?"?C@R @ PT"0 01 (@ K( @100 c 0 K Р?!?C (0  "@P0C0/#/BSF\ !* ( !@P0 C0 ς/#/BS,P00C0/#/BS 00C  \ 1  (K(( R 0T 0! 000C000C"Pwꫪ-   A01 BP3# q`a@P00L 0CV3TP00` 0# pa0 ` 00C Q`3`# PQ @b QP3P# b0 0d0#0000C0a  ` "! /@@:0@C/o b 0002S@c RZ0@00C  ꫪ -LMpR@ Q01X(K0AS0bP'/-B B7-<)08C8'Z, (0AB(R0388##@ Ѝ/  p  Y0bڌhO-`M`Q 0`Ѝ10@/ob9^h0N0nT339C9C88##@#!B4 b'+x (BȠ "(9B78C8^'B(BȠ "(9B78C8(X ("(8C8 n2c(8#x0n39C8BX# @#!B4 b'+x (BȠ "(9B78C8^'B(BȠ "(9B78C8 ("(8C8 NS28#8'("X 8C8 n28#80n3'9C(8"X# @#!B4 b'+x (BȠ "(9B78C8^'B(BȠ "(9B78C8ȟ ("(88 N nC8C8S(A"(78C8BP`€Q P8C87 @`)'- 97w=C#0C8C87)Q!X x \0 蝰΄ 40 蓰>  0  mpAH$@-pP`RQ! Q Q > : \0n.2@0P, 0s 0[>p>`>P0@  /ll /P0 /dlP 00/mP << 0Q(0 R 0C\/Lplhl P-@ 0 $l P 0@/lP0/mp-@P@ Q H`P0P  4   p/0!  mnm-PP@` RQpp S @0@ 0 0 /0  0(l8lm(P  Q\dlTTTTTTTTt,0/$/ ////P P0 /mP  |0(P R$,40/(/$/ ///mP 0@-@P@0H00S 0S 3/$PPP0 P[YP0lo p@-`Q00R00P@Pp\ 0pdV @0m<00Un<t000pml0@-PP@00PQ0@ 0Q P P @$Y@`P P`0 @X0@P`0yP @ Y@`hlLplHl|lll@-@P R Q wP  0  mE-鈂M`PPpRppJP@`XT2@p W,2   l Em!p 1`\ ЍC^1 0lm 0CQP @E9U 0@R/ R& R R R R R0900@@ @ 0@ @ 0@ @ U  0) 0) 0) 0 ) 0 ) 0) 0@ ULmHllLl@lPlxA-`@DP^P(BP0U2   S2   ES1   1   P6  ^A LP@- PT 1 R0@TL -dRW\ X!0P1@DAQ4A0Ao@PNC@P0  (̀ Qp] Q 0PU0@T ]t GC`<@ -]@PrpC\l`LhLXLdllLLXlTLTlT2O-pLLLPP R( R/2F pP;BŸ @ `^pT 1Q; JP8 Q T! TNPx1E ph``!0S# 401E p $$! P   L00SSW  > |000 P`LV` ` @@KQhT,0 `PjmllLplxlhldLLllL`LHllltl@-@PP`ph0 R0S IPp U80  V,0  W 0 0 0hl\lXlPlE-pS00P@`! 0Q38Q QP0S00 V\1\  La PH1H0!UPPP 2 P  0QV QPa R ! 0P 0 0Q eV\|0 P  XT0  W,0   kLldlHlhlLL@lllDl`l|lltlp@-@PmT P0  @p0 PpnP`NPPH `p0 Pp Ppm$Lm0@-P`Pp@W|k@P RnPP Pj lNP(0P |Pj@ H: nm @-(@0S U#vfmH: O-@P 1  N? Q`V Q ,pHp P Q P` pP( PQ - Q 1Z7 [3-PԐ԰  DP 0R0 - R -P\ 0 0-P  P4 P08` -lhllLhLXLLL\LllE-@P 1 R 1PL 0SP!nQ PP1QڈC0S= S (1\ = ^=PZ0{0 0*P 0SP` S 0PU`V `P Ὢ 0ጫ 0QPP` ApEhlLllLXLlhLx@@@p@-@PP`@pH0 RQ9A 0Y#p#Pphlp@-PP`@@p2 RQ To TW TOQA0SQQA1!\00BO TM TO D Q> HMl!PO ` Pp4( @41T !@@!Pp0^ 0CQppQ Pp0pQfʘ pd@dh 00 @Pp @,0P TpGhlLLplxl`LlLmO-@(P00TRXXXbX$p 0S* PUB440 b\k:"0 "S P P P 0 Q: P !0^&  R g^P1P!  h p e Y 2 0S PU  'P( RpS0P S PP ` R 0 ( Rp( RpQ OrPs p8  h<0  hlHlDlLldlL@lll|lLltl`lm-M  0DЍp@-@P` h00S 0S 3/DPQPN p@tp+PASP@pl0@-@P `00S 0S 3/<PQPN0@p+P#SP@0lp@-@P` h00S 0S 3/DPQP`N p@5p+PSP@pl0@-@P0X00S 0S 3/4PQPM0@g+PRPlP@-@ Q,,Hd4Pl!RY p1 RR X!RK @1RD ( R= 1 R6 R/ 0R(  Sm,0T m̀ 0儨R p0 R X H0mlllllllm@mmmM@-@P0@" Q"|`D0tt,R  ?4; m 0@Ѝ/ T1 RD1' 0 KP1$   1 /   0R0 R0  |Rt/ @ 0 00<0 mmmmllmllllwllA-PPMp` `3PQ HßH# 0Q P %I$#@Q`P I22@Ÿ lX \0SVp Vu V]2p@ P00Qp2PL``0 8d @ B0\  Q\ A P  P R+A10QXU P\ H!@TQ@` @01`| NOo4!0A0\Ѝ01H @)Q`{0 @P$ @0n0g0tPiPmP mHH @H !4 hlLplHl|lllllxlml@-PPp` p3PQ@2TCT#0Q P 9H0#@P`P -H3 2@aO"P V V V Ÿ Q PV2@@ l2@@ R\2 QZK0"(Ÿ@2  P00CO TFP< DP  > 2I!Pd  P1 !Qx៵1\$ \AX!Q@= \B G4!@JP@`$1@`0\0 P Q G @)P`g Q0@ 0ngRl@]\ }GD0 @( hlLplHl|lllmxl`LlLlO-0M R 0 >0;ScR R R . 0 0STP' P P P P P 0 PC0 P>0 P90 P40 P/0 P* R0 00S"00S00S00S00S00S 00S0 P ]d dP@f \ @ 0@ᳰ[@H*q@0 p W 0  04 R R R R R R R0p000@@ W 0@P`p W0 @P`@k  \ lc@PcЍRR'R#ЍO`d Rx\ 0Sp -pQ@ ӧ G0@\P` \ Q P-W9/(8bV8 V# V \- \ 0S -#/(08b\- \ 0S -#/(08b\- \o 0Si -#/(08WbN\- \Q `V RK -#\/h08f`D \< Q 0S6 -!\/(0b- \% P 0S - \/(0b- \ 0S P -#/(08Wb/---- -^--Z R- R|-{ Rf-ehLXL\LQ-P@&ڠ0 `p瘀嘠@V- V  -P 0S #,S 07\` c@-/hLKXL\L-pQ@ӧ$ G0@\P` \ Q 0S-W /(0bV8 V# V \- \ 0S -#/(08b\- \ 0S -#/(08b\- \s 0Sm -#/(08WbN\- \U  R 0SO -#\/(08bH \@ 0S R: -#\/(08b- \) 0S R# -#\/(08b- \ 0S R -#/(08Wbʐ /---- -Z--V R- Rx-w Rb-ahLXL\LKK-Qp@[ڈ!1P` pp7 V= V. 0S P( =,L\ ZG;/X8ȠV e1 V PU \ ="P<R0Ƞ '`==V- V P -P Ƞ <0H(0Ql'=/ @T-KhLXL\L1p-0Sm SZ p1 R`QR m\@KD1@P\ 00" c<R0 \G`5\ 00" c<R0 \G`#\ 00" c<R0 \G`\ 00" c<R0 \G`p/mhLXLKA-`C83#@ P 0CPڰß 09aUTTUڄ_|3P = `ß PUӬPCpEHQ@@s Q ^ - U9/(Ƞ8bTA T) T Q- Q 0S R -#/(0Ƞ8bQ- Q 0S R -#/(0Ƞ8bQ- Q| 0S Rv -#/(0Ƞ8UbNQ- Q`  R0SZ -#Q/(0Ƞ8bW QK 0S RE -#Q/(0Ƞ8b- Q4 0S R. -#Q/(0Ƞ8b- Q# 0S R -#/(0Ƞ8Ub 0   RQ-P-----c-u--->l\lwKLhL\LXLKKm-,3TMH(0P0P4P0 2HPU,(E ዢ\ 42 p`༲8`"B 8qb@$p `@` $p,`8 j<8<EU p jR3 R* R" R R R R 8p p 0p p  p p  Up 4 <@H0@ 0T0 0 $0 pp0p$p  0@00p< pH0p  U Tp`<0 S<0`@0, \0@,0l(04 0 S(004ATЍ/|O-a}pذ@ 8/\  8/ 8/ 8/ 8/( 8/0 8/8 8/@ H` | 8/ VO-p ܟ 0PJ@J` 0^ 0 0f Ɵ 0 0v^ t0 0SEⳟH H0 0d^ ,0ߟ 0ܟA<zUUUUUU?Ah>- IM L 0L\8.̠ 0P> Ο @ Pd$t0` P7` 0pE `` QW PpM Q q0$ pD@d<1dp Z dp2 0Z@ 0P $4`3\< Q P!@4 +@l 01$Q@0 @p@ lP pp`  FY@$pHHH P p `1#Ă,#P`(p P $` 0`PS TL T1 T  R 0!  01#!# 0 0 PE`\ 0!  01#!# 0 0 PE` \ 0!  01#$"#0  0  PU``  PE@PP  Q  `1#T%`0 ` 0 0S `!` `P1#$"cP  P `0PQ ` 0!  01#$"#  P P!P P01#$"S 0 0 P PRP$  z  p;ȟ   Q@ @`(1#d& `0 0Q P A 00 D  0$h8A @ !  00#$(8"A @ Zp7 \ 0 S :S ǟ   ZA  PA1#T%0 P 07 @ !p 01 #$"0 0<A0 0@ Iߍ/Q`3 FP0$dp`Dpf4ǠF0   0A04 Y2 17d&00` 1`\k @ 0pT*0a룜0'ʠmtt p@@T@匀xG8lpWp hl\@@1P@|qᤀ\ppp!P`UP`fp|Ɵ` plV @ 4Ƞ$P`25ᘐ@ (@L P\0 P ! 0ž00.I0@  qI 00  ž@3 2 ΀I30 !ΉB32 H@pLh0 SL ڐ0pHD@ptp Rth0# ! " "  S ʬ hZZpid\cP`@!L\q pqlVR0 R& R R R R Rrpqlppqlppqlppqlppqlppqld\ppql#d< ̆K\,Yppqrrpqqpvqpxqpzq p |qp~qpjZЍ唐`Ă PL\p@4 ᔐT@ 0<ā|i.tP7 0Pq廙 L2T828 !DeP@ @瘐a1 `磙 1י<4 !4TĠ!1a@0`@狙 1忙$8 4@Po0OǏ,P0`$0(@0 , @$. , / Q, 1pL,P  D멉 @PF 0: >7뜉 X Fn儞 0`Ĉ l>&቉ 0TTL뀉D@F 0嬈 >pPq 0j F 0喈 =@[ 0 T F 0P倈 \=pPE 0t p ه>h d F 0j =̇@/ 0,( Ç(  |F 0T <嶇pP 0 孇 fF 0H> T<堇@ 0 嗇 PF 0( ;劇pP 0TP 假F<,<, X1F`!(+!L1\d;+ؠ0ȑ!;+ܠ0̑!:*ࠁ0Б!誟:蚟*ʟJ䠁0ԑ!ت:ؚ*蠁1ؑ!Ī:Ě*적1TP嬪 *堚j :Z0吚吪ܡ:$ㄚ優0 |:t*tt0 l: d*ddd @z@0 4:4J )0p@  H})9屆FLu)9婆E 8`p ᡆ 09 @8囆PHAL(8 PLHQ ጆT<)Pp M8)89偆kE 7}TqXA)9u_E 7qևX1 X\3(8gQE `7cȇ\AP\Q `%(8YCE (7U뺇`a`d`(`8K5E 6G묇dHWd( Y à4GX 0Ip` Z`p<Q# Q Q Q Q Q Q0p0  @@PP``0 Z0@P0`  (08@ ZP@ ` (08@@pYj P쥟f0Iࣀp` Zp pXR7 R- R% R R R R 0`c`p`pnp@ d p`PfPp0a0pl Zp0 $,@4P<` 0a b`ln@dPe`f Z@  $,@4P<`@p[;%h8(Q\n0`!RN@ Y>0!,$qRN'n@` q,a0Wn[`P; p Qp @`䐝 ! qA Qܐ0a0 q0 @  @@P $@`(Pp䀝[,0`48p<@$1( 0 `@^ lVa(A@ Q$0ll%Z1la0!l}P̥@  ͈1L]@`p @P p0 1@!ؐ倠ԠА@̠Đ倠̓弐@@`p㸠尐倠0M]`0Ѐp嬠娐ؐ@`0@0 pP夠0 崠`帐HP `0H[0p `la$Pl}ptqt!!pApaW@【$ 1@【0p pp@@PH`^ p@ P$@`APȀp   `!: pp0 1!†@`㜠p@〠 `p匀Pp㔐吠@〠@`@0P刐儠pAp嘀匐唠T@p  0P 0@ @@t\t9)i変@ P$p'3G0J N$@أ' 30JBأG`@'F D3cG0@PA`@У'倁W3cGAxA|!|qx1凱#0  <8 0,x@P LP 4@(lM]{ ͋` p<@ P8@ 4P( DY@ P` 7 03| Ët #p|Lx\h p 0l{l@`Pd| x00P 0@lt`pp`hdY 0 @|x^|xaPPw^ Q 1ʋp A\A-BCaa焁 A!0!1 `p〠@X`Lp\T倠P@ 0@P@@`pPH儁L倠\ X@X00P 0D T`Pp@H0 D@ [ cߍ-_pOM$0唀$jP` 0$00$04D@HT( , ubR0L00 00 R0d h 0d@0 0 Ŕ@ 4Ąf8@4!$ b0< fPLD f $ .1LLh.tQ\0T͇` 0|0t$,0H0x  0.0\0 PHPQ(tP 0D(DtPP$!d 1P 儐lI1|T0VC0f  f`⣑VB0 J6S S S fIP`JPf `@J0fP`VA0JPf  P0e#@eQf `VA J R0T0C `FR0@B2SP7 S0 Y Y H \0B0t0  R ZL\ X$l T 1 V娠G0f- 4 f`0JVB稠5\ \ Pf L`JЊf0` 0IJ 09 J[A`| f P`0fBX*0JVff0 J尀8Z T'B`F8 @J \ڈPUCX(t0 D$(t00d D(1ሀ帀00h 儀C0|T0 0B \ T0@T HBP10H| 0`F@x H0HP(t (D$< ,td一10 0hC0|T00 L  X^T'TP(0HC\H|0x00`F@ XJT0T(0HC\H|`F@xL 0R L0; Xڨ`l !x2C b @>$< @<\,@ 0f ̄H@! T0 0*0 #\0S S S S S S S\X<ڤ| @ P0xfĠHPH*" ̡U $Q !PE0ĠU 0 0 0 D@A @ 1 PE$AU @ HH`XWڨUe@ |5Ġ@! @@Ѝ/T\ş\% T0 0L1 0c+\RQ 0H0|`F@xLTşT 0 0L1 0c+0\RQ |Y`F@x10PU VC0f  f`1VB0J6S S S  fL`J0f`CJf `V@Jf  !@0a#@0a 0f `VA J 0e4E0Jtßt#T0 0L1 0c+\RQ 0H00|`@x  Q VC@0fP fUaŒ0J6S S S 0@eČ`PJ`e PJ`@e0PUČ`J`e !@0ac@0a!0`e P@UƂ@ J ` 0f<F0yJaT 0` F1 0l+VR Q 0|`@xdH00H XTCT\!0HCPH| `F@x H 00H >H0HL !T0 b 0L0# c +\Q,Q  H!T0 b 0L0# c +\Q,Q |T0儀H LX0`0HPT 0LRH`HLdL* ) zLq `!T0b` 0F0# c +VQ,Q TP 0HRàHlH||!T0 b 0L0# 0c#+\Q Q  H0T 儀H LX0a0H   \ L |0RxL0@PU p1"BxP PP 圁]堁0$ P,0X8 H0\`PdPhPP0P R0l p0 h R$0P ,0hP\P PHP` ( \D$0(  Q80`IQdPXVC0f f`QVA0J6S S S fIP`JP0f `CJPf`VIPJf P!0aS@a Pf `VE J R0T0C `FR0@BQP QHsXPH0Y<P YQl h0Rl<PCHhPfP0S0NLX PU,0H΃ R@ 0$ TQPV嬀尠Ef+ Pf`0JVE簠4\ \ fI`Jp%f`HJ 09 E[`Hĵ f P`0fB%0JVff0 J8Z T'B`F8 @J\|hPUCX$0 h,\Q 0H `0B (\ D0$(#180hC0dX0h 0Bh \0䀍!`\T4 d0HC\`F@XH0H 0X\`!pT d0LXH`F@H0h PH #0 , 0h  Q\H ` (D $0 (80aHdXh0HhI 0X\`!,TdH 0LXà`F@XH PHPH  PX\`0!0Tt0  HPHdX50`F@H0H0LPUL PUH@0\:<\ 1`T%  d0 0L1 c+0\RQ`F@\ Q`0T0 d0$ PL1 eQ+0\RSQH PXPH0Y`F@<Psp [ \1`VC0f  f`1VB0J6S S S fL0`J00f `CJf`VAJf  !@0a#@0a 0f `VA J 0k4K0J d0 0L1 c+0\RQ `@p [v \@V1```C@0e ePaUŒ0J6S S S 0@eČ`PJ`e PJ`@e0PUČ`J`e !@0ac@0a!0`e P@UƂ@ J 0k<K0J``-d0 `L1 fa+0\RcQH ` `@H0iH0(D0$ 1dP8( `BdX*  Qd0 e PL0% 0e+P\QQHPP !d0 b 0L0# 0c+0\QQꌎd H0BPàl'괎d 0HCR0l0:>d BQH 0h0t HPHdX5 c 00!d0 b 0L0# c +\Q,Q #ppad0 f `L0& 0fc+\Q`QH`y(D0$8(d!8 `BdX($0D(d88! aBdX `l P\@T0Ѐ@\ 00S0$ @048< < 1@.!$@ P@T 0@,h01 TH  h0L\h0H h0L\ Hh0X PP1P0B1Dl@!* ) O-O`MM0 Va1! yL ZPQQ0Oa0 P!Q\唱h @`D $ᔡ0Qྟ`4 V `>1R T!@@QZzAVG*h>@  pCXH>HΟ j 0<6Qhq\Nl `!`X ` -`a0C@QN͟`  N16m4q$0c:xh-0 0v\=APpA(PC0E aR0   `Pb00|QQ0UP ]m@ ! q< #t !t0J0 pv\A`V%P""qB0@ xlx|x PP0!1  01#$"2p0@ T0 Qڸ1K$pܡXP`,Pa0QU䱝͍ !J @1`4聍́k0AP !L@ !4P4  Q P1@pq "1 00 p !Q  1#T! Q  P 1 Asᄁ@@0 !, A @1,pp0\%$"0Qq0 p@QTa p > pH DH0H 唁 YyI`d9 0 P c L`唑TyTY@ c00P``豝&豍 0!@⡃ P@ TРڔqĸh @ P4 (6  0Q0D$à WUP쑝pTrr QxP ,|pD TbP0S  B[qx`ȟ1Po04Rb0rO "0B4S)|,ࡧD`x K8\AX 1 QU\ P0pE p0rO04BS t$  `ǠHX^@P500rO04BS$~. `Ǡ᥇8 0 P00OpE pr4,0BS~.@  Ǡ8^0 PBT"p^PTa[PP  P|PQTa1PQ4  0 00  L 0/XL  0 /xL :s / &0S S 5\/ 1@-pP# PP`@0"B@ Pi 0i0P@|i 0Ijl l@3C\P`li\0 iLD ` Pai 0.jhL?XLtL A xLp@p@-`PTpPPP@HiD @@P 0@>i 0 jphL  xL\\0@-@  lD0\ H0 0l 4( MlLlL-PO-PM`0Ѝ00S R   hr0 G@Ph 0iV 'ڈ2Z#C@Th`ph@ Ph 0i 0iŸ @@`p 2h`p`p!P YE1ZD$ 00iPU !jh 0oi9jL P [ `Z#Pk h h 0gZ*@P40QS80S<\ <0g[k lh h 0g@P 0iP Wh h 0g@P@PlhLL xL \lPl?LlO-:sM Ѝ (&0S0 S (5P b(00 03 e@C0Sa P(^( 4(Ġ("  2" 0A (c(Q@`pP@ BVP0W`p80@p $0Sk S< S @$3CB2 B C wf 0 L 1 6 Rӊ1娹 p+QA`` lapl由\\ ````  p `,\Q 0RP>YD   @,\   @ # RB0  @PP)f 0C  xC2D  @pp d@ 0L|fKY  0 \LXLlpLLl|L .xLL  ~hLMtL27ΟO- P@M >PpR00 S0B0mM ⤞P <P 0  PPV,ϟ lΟR ^ R  l>0\x=tM [C `V ᢏ@@ T``V  PPPڬ-0S < q" Q "ŠQ0 S = L Q 00}:s l<^ D= 5 \U ` `PP<* p` V@f V V P PP<* p^ @ P PP<* pb @ P PP<* p @T9P !&0S S !5^ PL P @PPn<* p/ P PPb<* p: P PPV<* p? @T 0 PPG<ʠ p %&0Sd Sb %5^^ 0Se P $pj P6CC̄  @PPɟd  9^H@}d9<  Pw<CH\o<9X% \ P@P@9 R Q[ڰE0  RQUNS) S! S S S S S \=^9 R50S1X-\)^%U"0S X0SX\^ 0SXUU [M\0ȟl7l X 87 Q W\ 7Q W\ '^ dVP@,0S 3/6&\y FV 0 $ă!4|&#ĠPG !Ơ0 S S !5^ P Qf 8  P  @D7Z""l x ;(-:x'   x $lG $ 7^`P0P"Y RK RI U$PU,8^D\ZP Po8@\B XX@ 8QP@ TX0S= S 8 R(0^$= PP  4.*!^B0EP,"c! 8)8:c bc` =hYh)0  ^#@9)C0  4",".: @ P @ P9  ` Z@ 0@`@ 0\fLh 0` @$@D7j@@3 o 0 S*Z C@0P ,H$_G-pP`A QA!P D0]`p X` 0'a@PQ` 0`a1Q 0YlaZ Z4@@Q @ L  cL!l P@"n0B A`fΎ` /".```b`f`0 P" 3͎0BU " ^ ^  " P d" 0N "pF$0Pp P$L0$4$$<$$$($D$T0QD0a Q/ g?C( ' ('m4l@-P@0<0@;0 ?1O-P 1PPPP M#!bP PP댑A!k p0`l!lpgp L!PP@4414 0(APsL PP0P P 0P XB(CPPPP@ 0P  0~- PCPP P PAPPP en<)d dd PPPPnhlllmdlLxllLLtlmLLpl8$lpLnp% 0@-Q@0QS| 0|P PQ`P LQ `Lllll@-p PP t@@0`0@/?A 0` ```````W`W00?0p@- @R 0CP `PP 0 CP x hPMoLP T`PDPP P+('n p@(`l0$@l<$t%L10@-@\P \ʬ0S S[ 1 RQS QY\1d Q "\3 (10 Q !0 SR RS0  a0PPʸ0S= S# 0 R0Q =S `|0跶P `X0 ᴷ`<0Q1Y=S `LhLXLplm|l@- @{80BPp`pp pML"], 0pp@p 0pPpppppT@p B)P $p(%Hll0$4$ M$ $LE-P@P@0 x[Pam̠010S+q` MZ 0@PHZ h1a[P 0LZ@P` 0V[P$\5 00S0 3/S2 @q 08`̃:PY0ap @P 0CPڠ 0 Y 0`pZ 0h}m ̠0@@0 r0l?m@LLl ?$@Ll2l"A- ddR@ N`@@@ @@@@8@S,RpQ 2)ɠ 2 T@p@ WPPP|PPP PtPPpPPlPPhPPdP n9'M P|Q|!>EJBX & ;,h@PP400K (@P PP$1Q a QA$g?CPA$m @P0@?-0 Ϡ @iD_B PP 0E@ 0$4$@l`lL$LKKH$mm`L4L R 90S 4 R /0S * P1 0 S"0S0 P0S( 2 P0S< F PP0S @d\"  > P8 X L1 0 0 0m̂ zk \`m . 0RJS BT^' ^ ^ ^ ^ ^ RLQ BC0RLS B>RLQ B90RLS B4RLQ B/0RLS B*L| @/ R BQ"^LQ0BSB\D0^DS(B^DQ2B^@Q:0@S6@\2P@U. @R*@@^ $*0S!@Q@LT@0LS@PLU@LQ@ @LT@0LS@ PvJPP` 1p-`RPAg0Q\0c TbTSQR0D ) TI0SFR! R R R R R  R60S2 R.0S* R&0S"T 0S0S0S0S0S 0S0S R Q P 0V p/e eO-鴁@ aQ1R     7 ppQ. P`PX l P0 0 < d P0 0  \ P 00  S P 00  J P 000Q P`00 R 0 R QD\QL  0 Bnxn|nnnnnn     nnG-KM☠    P pP`= Q  @ qP2 Qq 0 P) Qq 0 P Qq 0 P Qq 0 `P Qq P %V0  K(A A 0 `x\Kߍ`0 X0f CP0 0$X Dll  @-p`P@P@  00pA-`Rp@P4 0 FS PV+Rt R! R R R R R рXP^PPP0SP\P RPрXPVJhP V! F  VP\ P P       VGP 0RP0\ P^PRP\P^PVрXPP"3-" ?0,  0  #0  -V      "3-"0? <,0    "-" 0? <,0    "-"? <AP#"3-"?0,W"#.=0 ?<, ^"=#- ?0,N"3-"0? <0MO-pR` SW P  @46+6 RK P P |P  P\: iP` pWP- 8@\Ŕ \X?0 ,-" <0P@W  46+ 6 R 0$ !  +5" @P0  A W 0 8#77 ^. 5+" R R 0R  P pP O\,3? ,? = ,< 0Pp\, ,6? ,@D^:@D\60@DS2@DP. @DR*@D`Q $*\!@D^`@@V`@@\`0@@S`@@^` `@@V`@@\` ,D|4P@` j Jn \$D ``@@T\PY0 * @DQQ*^NR! R R R R R  @DR>@D\:@DP60@DS2@D^. @DR*@DQ $*^!@D\@@Z0@@S@@^@@\ @@Z0@@S C ŸP@`  RY @| #P<H2  0CP(B@0% @(P@Jl6`0P4\1 QN 2GF!<: ^V010f0f| P<1   C\D0% @0P@ P@P@ s q o mEp <80 |^H@@D 0|}$@7D 0\tl< H nnp   l  0 4 (   \HO-pWLM` ,?A PA@T CD EF0 B7$/ 〣 W @@TbW` p5P~ |>  P@@0 @ W  0: G30 ,B JK44P*@ PAB00B@PPP SQU:\ \ \ @AD0 D R\AL00L S^A N0@N TRU0A C00C SR@ 0AC0 C R\ AB00B S\A@L0L ^TzUʨLG P@s W  0cLjဃ < R{@ ZS:P  $0@0 UM  Rq G Pb G P[ G PT  | GP  J G0TS\  pI Q( $n OPP<  (@Q#(P%$%`*(0^(@0S @(TK*\# \ \ \0S @\^ @\0S @T%*\^ @^0S Q^ Q0S @T:$(P  RD\ P@  8 PLЍPy0 I q P@T(h,Q ( ,], GX($ @0D00B8(^0P8@ jP8@ R]80aPP S RR0@ ) P I0SFQ! Q Q Q Q Q  Q6 0S2 Q. 0S* Q& 0S" P0S 0S 0S 0S 0S  0S 0S Q PR 0PS8P R* U( sq 0P\ S\^Y 0 * @Q@Q*\NR! R R R R R  @R>@^:@X60@S2@\. @R*@@Q $*X!@^@LT@LX@0LS@L^@ @LT@LX@ D@,0ğ@P` $(8@a00 0Eo Sd@@BP\ RY0 * @QPQ*^NR! R R R R R  @R>@\:@X60@S2@^. @R*@PQ $*^!@XPLUP0LSPL^PLXP PLUP0LSP ?,0ŸP` B  R,B0S,L" H, Q,(" ( R0,P, ^) PP:P6Q,@UB!<8@  AQ1@@ 0: @T  (fPP D1Qd( ( PP,6P((@T0@B;B <8  Q:0G@$ (0@ltntp(P\lll nnnn,4@LtXh< 4 (  $(0P@0@ XL dd@09PA  0R PE@          @ 0 @A ,  0 (!P(@ \ 񟗍TLDTAT ~9P@ ||0R PE@e c ! B 0D@  2P( \ ꌠ|(d P% (x PpP3<"T G $Ps (R0$S0PNU 0]( RY * PEQQ*PNR! R R R R R PE^>PE\: PER60PES2PEP.PE^*PEQ $*0S!PE\P@X0P@SP@^P@\ P@X0P@S =d4 PP`  $ ~Pzl4IJG @H0Dn$j$h$f$d@  0ȈGZP#0 H 0 {HpG 0| P  ,%k8P %R PE@R P 00000000F0 F$V0S 0 N @> < Q A;8P0 C P0d 8PP0d8P @Z@@P P P P P '@b> 0 ,P <P L'P'T'X'/ PP P P///P 0 /$L/Ḻ/Ḻ@-@PO 0SL 4WP$RPLPFP@P:P4P.P(P"P pP \P HP   ,08DLP10@-0@@P P!PꤦPS 001K-K)01 l1P<`0. D1H Q8 B\&  R# 0 S \ 0 S \ 0 S 0S %0000K=9PU h\(XXx0( 0Pl`LXl4L8L<pm(L$Lz@L@-K@ G0 0 Q C`0hhh C X0 0C R440 [pK\$L<lX@-0@ llG-`RPp@XXX@ 0@000V d P@llld0@-M@  p P Ѝ8̃ lD0@-M@  p P 040Ѝl$1@-0MP@)Q p ` T T +0 P@`ۍ a Q  \ P U6 L1Q6 0 N640 @700^_E?pPE?W2 `J p蠟 W6 056 02600 @7 QG?pG?^ `$ V K4Ѝ:a `P0Pm DD$@@@-|s|S0@S` QG T TPßPS@  @ @0@ @0@ @0 @ \@ŸB 2 0 20 20 20"  2 \0h1lA 0OܓP1TAdA .堡q @* @3圱@\C` 0OD1HAp!1سp[+T1SA`qSq$,XAa$L1fd0OQ014AD@`1C$8@HAQ%帐帅廀 [ 倠U崐h4▣hl@pX崰啀'X` d0` 0崠X`\p(HR(0 PPT`0h`pl0`PHL8(&L8dl $%̠XK\P ):ⰊJ \0 @0ˆ:\:0t d0 \0@L*\H* 80Q 0  \:\:0I \0 0\90P7@`q0` q!@X@@倠@@P``p= ^1 q0@c* 0x| 8 p0t@ 1((h0l@* A` d008&2 B @\00@1\10Ё 0 \0@!\! 0Q 0  lA\d1\`10PAD \0 0\(10gGaq@W@PAANQ`pK-&0W  0cV@ ލ\  ]p(! h0\ +pp(P0 = \:H$@l8$KD$K?x%KO-P@LaM0 P p0e0C p0 eSp1*0 eW**  0 eX#*  0eZ*  0 eY*  0 e[*  0eP*  0e^:Ѝ@lHlO-TaMPAPp 0p0 ; @``  R`p)0 0 R#   R00 R   R00 R  R0 0 R0ߍHl@lO-MP"PR䏟+@`TTL2P@`TBP ` F 琏P0`2& X``X2  `BPDod 1 d"XXdPp@ 0P嗛a DbHre QʠUPP5U`0P@ (@( 7 C0 à>  ŀ P@pP @p@Wd pp0YvpW pWk p pYg 0 pǠW0W ((d 6   0s^@`Q0¾op5!,*@Pe `1O S$ `@u p  pW" (@0(1 5e   pà`^0@Qp¾opY5!&ʠ@Pe `1OS! @`Ł (5P1 P@0 `T R# R R R R R R@@@@@@@Tf@ 0 T   Nß# 0 4,0c$ @2!00 @ßT P@T(@pTP>P@`T@PT 4ß4# p 4tp0g @$2#q0B0p @T Ÿ" p 4t,pg4 @3!Ÿq  @|2TppP dŸd" ` 4l0@c$2d 0((B00`Ÿ" P 4TP@e$ 02$QA$P @T$0@PT`-$@P @UCV3$p@`T$@T @@! P 4TP0e @$ Q2#$0@00P @PT` 0 40,@c 0$@2!$@ P @U ``p  p4$|0c$ p2!0p0 DLTL@LL( @( 80 I  C ^0`Qp¾op5!,࣪Pe`1O S$`@%   p 4|0@c$2t 0A00pR$$Q p 4\0@c$ 2T``A0 00,P6q` 4tp$g02!A Ba  `4$l0c$ 02aB 00`<<" ` 4l0@c$ 02dxxB00 `0 p p p p(`P0(`r p 4$0c$2,q0 p0 44# p 4tpPg$ 02%ppSq p s  p4$0pc P$2'0qSp0 (,<-p MR刜 ` P@4ā%D$:A @0P  $4aT%ʠ`Q P1@ $ā0D$: A @0a 0 T` $0"ZX 0 P hkRd[@P@@P'P9PK P]@To \  0 $ă1 ,9 @0P  0 $ă1!,90 P  0 $ă1$"9 0P  0 $ă1$"9 0 P  0 $ă1$"9@ T0  Ѝ/0 DĂ1@$@"90@@Pa  0 $4 4#) N00S +ll ` P 0@$Ą0D$ʠA  @!0 T !Z0AQ @P`ʁQ Vʼ弇 @ 4T`@`Pd!*A0V0 @P8Q  P4$`"Z0 V0 PP# @0 $D1,J  @A0$0`0 !ZV PPX"劑PU`@PLL0@P`P U Qp@PY`P Q)Yj̥`VY  R`V R  \1`V R DE ` P4@d&9U`A @0Q0 $0$"  A4`\@` ğ  `P0$DT%9pDP 0A ` 4!` ` $d 9P0P  0 $ă1$"9  0P @P$`P@6PdPQ@P  0` $Ć1`!`,9 0 P`   0 dă!`4`#)  `P`@   0 $ă!4 #9 0dR `0D$ȠT% 4BP0 0A $4a(9 쁟aP P0` `  4ā&1`,) `0  @` 4d$`1 "I 0@`0 P 4DT%)AP0 0 A0$ 1$"9  P0P 0 4Ă1$1") 0  0 4Ă!4#)0  0{DLLLO-tT XM $@@G@`A4  PQ A  p  0C|  P4  0@(T  0  @  0  @  0  @  0  @  0  @u  0  @j  0  @_  0  @T  0  @I    0@>q T2ꁯA  p  0'R  0@ rn   0 @   0 @  0 @  0 @  0 @  0 @  0 @  0 @  0 @   0@qs , ߍ脰LLLLHL8Lpp@-̌!J#Z 4 5\ @D!VK 6R#2"<$!R \dUV@L*0b `VP0b ǠV`F P! !0b V`F P!!0b V`F P!,!0b V`F P!! R&^b1>!,°T \JUVp!@ Ptp@T:8#Z 4 5 4F 5 5Vm ``M@xPc{  10/p1QQP!1/Ɛƒ /  0@-PpC--3#---3# & * Z>>*S 51:3`//// 2RS"|"!R/.&/* b b<055 320:6// ! 02BC< ",#    31 Q1101 RS /0  R0r‚ /0 R5r/ b1 b a0/2 B 30C ; 2 3  /0011 2$  34 //+; 2 3:  B  2! 2 S01} ŠS0C !S0C !!S!1C ,!S1C !2,°RS /  0r‚ /0 R2 B 30C ; 2$ 3 34 !1/G-T``p3@ @00bCQ@`  @T:@-@3/0@Ds--l reenter!!!!!!!!OdWrap__Init(): MutexCreate() failed for global mutex.OdWrap__Init(): MutexCreate() failed for global task mutex.OdWrap__Init(): MutexCreate() failed for global queue mutex.OdWrap__Init(): MutexCreate() failed for global semaphore mutex.OdWrap__Alloc(): malloc() failed: S%u. OdWrap__TaskCreate(): Reached maximum task limit. %d OdWrap__TaskCreate(): Invalid priority: P%d. OdWrap__TaskCreate(): pthread_attr_init() failed.OdWrap__TaskCreate(): pthread_create() failed.OdWrap__TaskDelete():taskid is not exist,taskid:0x%x. OdWrap__QueueCreate(): Reached maximum queue limit.OdWrap__QueueCreate(): OdWrap__SemCreate() failed.OdWrap__QueueCreate(): MutexCreate() failed.OdWrap__QueueSend(): Invalid message: NULL.OdWrap__QueueSend():Queue id is not exist,queueid:0x%x. OdWrap__QueueSend():alloc memory fail!.OdWrap__QueueRcv():Queue id is not exist,queueid:0x%x. OdWrap__QueueRcv(): OdWrap__SemWait() returned eOD_RET_AGAIN in blocking mode. OdWrap__QueueRcv(): OdWrap__SemWait() failed while waiting on a semaphore.OdWrap__QueueRcv(): Unexpected value: msgbP is NULL.OdWrap__SemCreate(): Reached maximum semaphore limit.OdWrap__SemCreate(): MutexCreate() failed for semaphore.OdWrap__SemCreate(): pthread_cond_init() failed.OdWrap__SemRelease(): No such semaphore: S%u. OdWrap__semDeletle():semid is not exist,semid:0x%x. OdWrap__SemWait(): No such semaphore: S%u. OdWrap__SemWait(): pthread_cond_wait() or pthread_cond_timedwait() failed.MutexCreate(): pthread_mutex_init() failed.MutexLock(): pthread_mutex_lock() failed. MutexUnlock(): pthread_mutex_unlock() failed. MutexDeletle(): pthread_mutex_destroy() failed.ret=%d,%d Uint64Add(): Overflow: H%u%u + H%uL%u. Uint64Divide(): Divide by zero. Uint64Multiply(): Overflow: H%uL%u * M%u. TH%uL%u:TH%uL%u:OS_ERROR: (err=%d) OS_LOG: (err=%d) %sOS_LOG: %svos_init(): OdWrap__SemCreate() failed for SleepSemId: E%d. vos_init(): OdWrap__SemCreate() failed for tmbTimerSm: E%d. vos_init(): OdWrap__SemCreate() failed for EcbemId: E%d. SVCInit. VosPoolInit(): NULL poolConfP. VosPoolInit(): Invalid buffer pool id: P%d. VosPoolInit(): Zero buffer chain count: P%d. VosPoolInit(): Re-initialization of buffer pool: P%d. VosPoolInit(): Semaphore creation failure. VosPoolInit(): Buffer size rounded up for alignment: P%d, C%d, specified(%d), rounded up to(%d). VosPoolInit(): bufPoolSize smaller than needed: P%d, specified(%d), needed(%d). VosPoolInit(): SetUpBufChain() failed: P%d, C%d. SBI: P%d, C%d, CC%d, F%X, S%d. VosAlloc(): Invalid buffer pool id: P%d. VosAlloc(): Invalid buffer size: S%d. VosAlloc(): Uninitialized buffer pool: P%d. VosAlloc(): Cannot create pool chain: P%d, S%d. VosAlloc(): tFbmBcb allocation failure: P%d. SBA: BP%p, T%d, N%X, S%d. VosAlloc(): Requested size buffer not available: P%d, S%d. SBA: Cross the limit: P%d, C%d, BPS%d, CPS%d. VosAlloc(): Pool expansion failed: P%d, C%d, S%d. VosAlloc(): Non-zero free count, but NULL bccbP->first: P%d, C%d, F%d. VosAlloc(): NULL bcbP->next but non-zero free count: P%d, C%d, F%d. VosAlloc(): Allocation without free: P%d, C%d, N%X. VosAlloc(): No buffers: P%d, TN%d, S%d. SBA: P%d, C%d, BP%p, N%X, S%d. VosFree(): Invalid buffer number: BP%p. VosFree(): Buffer free twice: BP%p, N%X, S%d. VosFree(): Buffer pool not initialized: N%X. SBF: BP%p, N%X, S%d. SBF: BP%p, N%X, S%d. SvcPoolGetBufNo(): NULL buffer.SvcPoolGetBufNo(): Invalid BCB: BP%p, P%d, C%d, next(%p). SvcPoolGetBufNo(): On free buffer: BP%p, N%X, S%d. SetUpBufChain(): Buffer chain allocation failure: P%d, C%d. ExpandBufChain(): Chain's buffer size is too big: P%d, C%d, S%d. ExpandBufChain(): Block size adjusted: P%d, C%d, S%d. ExpandBufChain(): Buffers allocation failure: P%d, C%d. SBE: P%d, C%d, BC%d. start_decoderK%` ,K%` ,  pqrstuvw~}|{zyx`abcdefgonmlkjihBrdRecevierTaskbrd_receiver@>"V}DProcessPcmData/var/offlinetableError: Error, cannot open %s for reading. Error, cannot open %s for writing. /opt/lpc3250/devcfg/var/config/opt/lpc3250/chncfg/home/configRead ErrorError: cannot seek to offse: %d System configuration CRC errorInit Mutex for config file error /dev/i2c-eeprom0Read device id Errordevice ID is %s watchdog is %d Create Player Message Queue fail! Start Player Manager Task fail! Start WaitCfgChangeEvent fail! /var/cfg_eventcreate pipe error!open pipe error!read pipe error!%s decoder is running Send msg fail! utf2gb error!!!!!!!!!!!eSVC_MSG_TYPE_DGT_BRD_START session id : %d multicast addr : %08x multicast port : %d session type : %d stream type : %d alloc memory fail! Central ctrl received invalid msgType:%d /dev/mmcblk0p1eSVC_MSG_TYPE_DGT_BRD_STOP stoped session id : %d current session id : %d Central ctrl received msgType:%d /dev/watchdogFATAL Error! Can not open watchdog watchdog enabled /bin/tar zxvf /opt/lpc3250/usr/bin/wget.tgz -C /tmp/Start PlayerEventRevTask fail! can not create a netlink socketbind() error/dev/iDst_ctrlError, cannot open spiuser space userPid:%x IOCTL fail! IOCTL_IDST_CTRL_SET_USER_PID device:%s Exit.recvmsg:msg type%d, value:%d Start Mp3PlayTask fail! fifo flag is errorread data is over, data len:%d! %s/%02d%s/%02d%s.mp3/mmccan not open file %s /dev/vs10xxopen vs10xx failedfile playing ended fifo is empty data is error, quit the player, len:%d write mp3 data error!No MP3 Diropen root directory errorIndex is valid : %d folder name is too long %s/%scan not read attribute : %d Index is not director : %d %s/%02d%sopen mp3 directory error : %s file name is too long Index is not a file : %d can't open %s error! :%s mpg123 get parameter error/tmp/musicInfo[ { "DirID":"%d", "DirName":"%s", "MP3file": "FileId":"%d", "FileName":"%s", "mp3Len":"%d", }, {} ] SDStart PlayerAnnounceRevTask fail! Start NewHbCtrlAnnounceRevTask fail! Start PlayerCmdRevTask fail! Start PlayerCgiInfoRcvTask fail! Start P2PRevTask fail! setsockopt: %d %d socket creating err in udptalkBind errorset timeout errorSendDataToServer: Create Sending socket failedSendDataToPeer failedreceived server command errorcnt software donwload type is error,type:%d /tmp/lpc3250.tgzw+b/tmp/uImage/bin/chmod 777 /opt -R/bin/mkdir -p /opt/temp/bin/cp -af /opt/lpc3250/devcfg /opt/temp//bin/cp -af /opt/lpc3250/chncfg /opt/temp//bin/rm -rf /opt/lpc3250/bin/tar zxvf /tmp/lpc3250.tgz -C /opt//bin/chmod 777 /opt/lpc3250 -R/bin/cp -af /opt/temp/* /opt/lpc3250//bin/rm -rf /opt/temp/usr/sbin/flash_eraseall /dev/mtd2/usr/sbin/nandwrite -p /dev/mtd2 /tmp/uImagerebootSendDataToServer: Server IP is invalid CMD:PLAYER_CGI_MSG_TYPE_GET_SYS_STATE,%d CMD:PLAYER_CGI_MSG_TYPE_SYS_CTRL,%d 231.10.5.84forward socket error: %d %d CMD:SERVER_CMD_DGT_BRD_START,%d CMD:SERVER_CMD_DGT_BRD_STOP,%d CMD:SERVER_CMD_GET_STATE CMD:SERVER_CMD_SET_CFG CMD:SERVER_CMD_GET_CFG CMD:SERVER_CMD_BROADCASTR%d.%d.%dreceive server upgrade app url, len:%ud, url info:%s App download url is not invalid, url:%s /tmp/wget --no-check-certificate http://%s%s -O /tmp/upgrade_app.binApp upgrade command is:%s download complete, ret:%d ls -al /tmp/upgrade_app.bin/tmp/upgrade_app.binget upgrade tar file success, start to tar xvf upgrade app filestart to upgrade kernelget kernel file success, start to upgrade kernel file127.0.0.1Socket Creation: Write To Socket Failed...SOCK READ: Error in recieved packetRead From Socket Failed...0.0.0.0eth0[-] ioctladmin/etc/boa/www.passwdhwclock -walloc memory fail 111! Can't Open Serial Port SetupSerial 1SetupSerial 2Unsupported data size Unsupported parity Unsupported stop bits SetupSerial 3tcsetattr fd1/dev/ttyTX0Open serial port for control panel ErrorSet Parity ErrorStart CtrlPanelSerialRcvTask fail! get gpio %d error PlayerCntGpioOut ioctl fail Write audio device fail! device:%s /dev/i2c-0Can't open device:%s /dev/gpioopen /dev/gpio: fail IOCTL fail! device:%s Start CntGpioInputReadTask fail! Start VorbisDecoerQId fail! /dev/mixeropen /dev/mixer fail!!!!!!!!Start VorbisDecoerTaskId fail! /dev/dsp open %s fail %d %d open sound card successfullySNDCTL_DSP_SETFRAGMENT errorSNDCTL_DSP_SETFMT errorSNDCTL_DSP_NONBLOCK error SNDCTL_DSP_CHANNELS errorcreate broadcast receive socket errorlen:%d is invalid, data_len:%d failed to create a celt modeFailed to create the decoder: %s SNDCTL_DSP_SPEED errorclose sound cardclose sound card failedcelt decode failsound card ioctl failed in function:%s sound card info.fragments < 2write sound card failedenter insert process, cur remained cnt:%d enter drop process, cur remained cnt:%d quit from insert state,enter normal statequit from drop state, enter normal state%s statistic: rev_pkgs %d forward_pkg %d invalid_pkg %d decoded_pkg %d %s received a decoder start message %d %s Decoder is stopped gb2312utf-8fileHeader info is not invalidcant find upgrade version!!!!!!!!!the required version:%x is same as current version, no need to upgrade can't open file:%s Read upgrade file header fail, can't upgradeThe file number is not expected, stop upgradeupgradeFileHeader.fileNumber:%d, upgradeFileHeader.totalLength:%d The file length is not expected, stop upgrade, totolLength:%d, fileLen:%d Read upgrade file description fail, can't upgradeThe magic number is not expected, stop upgradeunknown errorwarning: %s NULL passed a decoder structureReferencing a decoder that has already been freedThis is not a valid CELT decoder structureNULL passed to celt_decoder_destroyFreeing a decoder which has already been freedNULL passed to celt_encoder_destroyFreeing an encoder which has already been freedThis is not a valid CELT encoder structureOnly mono and stereo supportedNULL passed as an encoder structureReferencing an encoder that has already been freednotification: %s detected pitch when not allowed, bit corruption suspectedsuccessinvalid argumentinvalid modeinternal errorcorrupted streamrequest not implementedinvalid statememory allocation failed@H\l|  $,R ny#|.:EQ\fLojv{~Fatal (internal) error in %s, line %d: %s entdec.cTrying to read raw bits before the beginning of the streamuint decode errorentenc.cbyte buffer collisionrange encoder overflow Using a mode that has already been freedThis is not a valid CELT modeNULL passed to celt_mode_destroyFreeing a mode which has already been freedThis is not a valid CELT mode structureSampling rate must be between 32 kHz and 96 kHzOnly even frame sizes from 64 to 1024 are supported "(0<Ndd,v8 N t0%.< N           $  #(  *..%#"! "#  .1..*+,/2430'  55107BGGGA@@8/)% <@JJWgjfede_PE?7/$Rbands.cdenormalise_bands() not implemented for >2 channels̷m۶98.Nk(=<7)\Kh5rO{>Lo/OF}gXRoX #؊ kL?w'c/8+?7aHxC.+goG?/O?[ԡ_KZm2|WCُC(e lڏ^ۑaGFiV/x&_5$ m<( kiss_fft.cIn-place FFT not supportedOnly powers of 2, 3 and 5 are supportedMessage: I am done with this track.A generic mpg123 error.Message: Feed me more input data!Message: Prepare for a changed audio format (query the new one)!I have no idea - an unknown error code!Note: broken frame %li, filling up with %lu zeroes, from %lu No error... (code 0)Unable to set up output format! (code 1)Invalid channel number specified. (code 2)Invalid sample rate specified. (code 3)Unable to allocate memory for 16 to 8 converter table! (code 4)Bad parameter id! (code 5)Bad buffer given -- invalid pointer or too small size. (code 6)Out of memory -- some malloc() failed. (code 7)You didn't initialize the library! (code 8)Invalid decoder choice. (code 9)Invalid mpg123 handle. (code 10)Unable to initialize frame buffers (out of memory?)! (code 11)Invalid RVA mode. (code 12)This build doesn't support gapless decoding. (code 13)Not enough buffer space. (code 14)Incompatible numeric data types. (code 15)Bad equalizer band. (code 16)Null pointer given where valid storage address needed. (code 17)Error reading the stream. (code 18)Cannot seek from end (end is not known). (code 19)Invalid 'whence' for seek function. (code 20)Build does not support stream timeouts. (code 21)File access error. (code 22)Seek not supported by stream. (code 23)No stream opened. (code 24)Bad parameter handle. (code 25)Invalid parameter addresses for index retrieval. (code 26)Lost track in the bytestream and did not attempt resync. (code 27)Failed to find valid MPEG data within limit on resync. (code 28)No 8bit encoding possible. (code 29)Stack alignment is not good. (code 30)You gave me a NULL buffer? (code 31)File position is screwed up, please do an absolute seek (code 32)Inappropriate NULL-pointer provided.Bad key value given.There is no frame index (disabled in this build).Frame index operation failed.Decoder setup failed (invalid combination of settings?)Feature not in this build.Some bad value has been provided.Low-level seeking has failed (call to lseek(), usually).(PHl$Ht0`T,T ,d  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~€�‚ƒ„…†‡ˆ‰Š‹Œ�Ž��‘’“”•–—˜™š›œ�žŸ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿInit rate converter: %ld->%ld Truncating stereo boundary to sideband limit.                                                                                                                                                                                                                                                  lL: ; A L: ; A UUUUUUUUUUUU?$I$I??B!?AA?@ ??p?@`?@P?@? 0?@ ?@ ??鿚ٿ??qqqqܿqq̿qq?qq?qq? L: ; A Note: missing %d bytes in bit reservoir for frame %li  $,4>JZn V@ "*26L $0BZx>@ 8 $*2<HXjJ@ "(.66 $0BTr,z@ B $,6BRf~(l&@ &.8DTf $0BZ~8@ "*  $,6BP`tP @  &.4<D:6 $6H`~, @  * $,6BP`rL@  &.6>FL$ $6Nl8@  ,  $,6BP`tP @  &.4<D:6 $6Nl8 @ ( $,6BP`tP @  &.4<D:6 $6Nl8 @ ( $,6BP`tP @  &.4<D:6 $6Nl8 @ ( $0<HXlP68:<>@  (08@LZ0Hl t@ $            !!!!"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""l6 6 6 ,7 l7 7 l8 8 7 ,8 8 ,9 $$ $Note: Junk at the beginning (0x%08lx) Note: Looks like a RIFF header. Note: Skipped RIFF header! Note: Skipped ID3 Tag! Note: Illegal Audio-MPEG-Header 0x%08lx at offset 0x%lx. Note: Could be a BMP album art. Note: Trying to resync... Note: Hit end of (available) data during resync. Note: Skipped %li bytes in input. Note: Xing/Lame/Info header detected Note: Xing: %lu frames Note: Xing stream size %lu differs by %f%% from determined/given file size! Warning: Xing stream size off by more than 1%%, fuzzy seeking may be even more fuzzy than by design! Note: Xing: %lu bytes Note: Xing: quality = %lu Note: Info: Encoder: %s Note: Info: rev %u Note: Info: vbr mode %u Note: Info: peak = %f (I won't use this) Note: Info: Radio Gain = %03.1fdB Note: Info: Audiophile Gain = %03.1fdB Note: Info: ABR rate = %u Note: Encoder delay = %i; padding = %i D}"V]>+.@ @` @` 08@P`p@ (08@P`p@ 08@P`p (08@P`p (08@P`pNote: doing RVA with gain %f Note: Want to enable format %li/%i for encodings 0x%x. Note: Enabling all formats. Note: Disabling all formats. @+.>"V]}D`!`TIT2TALBTPE1TYERTCONTranslated ID3v2.2 frame %s to %s Ignoring untranslated ID3v2.2 frame %c%c%c UTF-16 BOMLatin 1UTF-16 BEUTF-8unknown!Note: Storing extra from %s encoding replaygain_track_Note: RVA ReplayGain track gain/peak replaygain_track_peakreplaygain_track_gainreplaygain_album_Note: RVA ReplayGain album gain/peak replaygain_album_peakreplaygain_album_gainNote: RVA peak %f Note: RVA gain %fdB Note: ID3v2.%i rev %i tag of %lu bytes Note: ID3v2 %s frame of size %lu Note: Storing comment from %s encoding Note: ID3 comm/uslt desc: %s Note: ID3 comm/uslt text: %s rvarva_mixrva_trackrva_radiorva_albumrva_audiophilerva_userNote: RVA value %fdB Note: RVA2 identification "%s" Note: Storing text from %s encoding Note: ID3v2 %c%c%c%c text frame: %s COMMTBPMTCOMTCOPTDATTDLYTENCTFLTTIMETKEYTLANTLENTMEDTOPETOFNTOLYTORYTOALTPE2TPE3TPE4TPOSTPUBTSRCTRDATRCKTSIZTSSETIT1TIT3TEXTTXXXCOMTALTBPTCMTCOTCRTDATDYTENTFTTIMTKETLATLETMTTOATOFTOLTORTOTTP1TP2TP3TP4TPATPBTRCTRKTSITSSTT1TT2TT3TXTTXXTYECOMMTXXXRVA2USLT   $,4<DLT\dlt|     $(,048<@DHLPTX\`dhlptx|t|{Ltautogenericgeneric_ditheri386i486i586i586_ditherMMX3DNow3DNowExtAltiVecSSEx86-64Decoder: %s nodec\4UL6D$8,"#|4<!,#h5 ,08DLPhNote: Input data end. TAG|umf_WPIB<60+&" #)08CO]n$Ho&[E P(qLbN %' elk]d*D!Ls CS8D1ySMxd("RX/@ J \!&,28?ELRYv`rgnu|8qؠi -T / I"#h$$%k/H\  H   @Ēȏooܐ,2 &d22<,l9 Фޤl9 "`,HFDBl9 @>>>>>> > ><<<<< < < <:x"! "! 3#210"! 3#201"! UETS5D%RQ4PC3$BA@#210"! UTES5D%RQ4CP3$BA@#210" !UE5STD%RQ4CP$B3@A#210"! wgvWufGtVe7sFUTc'rdpbE5SDq6&%RQ4Ca`P$B3A@#210"! wgvufGtWUVe7sFET5S'rdqp6c`D%Rb&aQ4PC3$BA@#210"! wgvWufGteV7sU'rFdqp6cETD&ba`5S%RQ4CP$B3A#2@01"!  %k3g~o_O?/n^}N>m.]|Ml={-\zK Lk<,[ jy;Z+ixwv J:Y* hI9Xg)Wu8fGtVes HrFd(7'qUp6cET&b5a`SD%RQ4CP$B3A@#210"! CIo_~O?/n^}N>m.]|Ml=- {\Lk <z ,[Kj;y+ZiJx:Y* hI9w X)gvHWu8fG(tVe7sF'rdUqp6cET&b`5aSD%RQP4C$B3A#2@10"!  3o_O?~}^/nN>m{]|Ml=\ Lz<[y.-;k, KjZ+ iJx:Y*hwIWg 9X)v Hu8f(GtV7seF'rdUqp6cET&ba`S5D%RQ4CP$B3A@#210"! =o_O?/~q n^}N.>m]|Ml=-{\Lk <z,[K ; jy +ZiJx:Y*hwI9X)gvHWu8f(GtVeps7'rFdUq6cET&ba`5SD%RPQ4C$B3A@#210"!       xldlL ldlLHLldL| xldlL| xldlL|̭,D\tp9 9 9 9 9 GCC: (GNU) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2GCC: (crosstool-NG-1.3.1) 4.3.2GCC: (GNU) 4.3.2Aaeabi.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame.ctors.dtors.jcr.dynamic.got.data.bss.comment.ARM.attributes (( !HHh' p/ 7oܐDȏS \ Ē@ e`k q) w)nHHDp lpc3250/usr/lib/0000777000175100017510000000000012153600451011254 5ustar 10011001lpc3250/driver/0000777000175100017510000000000012301006230011156 5ustar 10011001lpc3250/chncfg0000777000000000000000000000001013700557164012025 0ustar rootroot